BS20604.complete Sequence
170 bp assembled on 2011-01-11
GenBank Submission: KX800897
> BS20604.complete
GAAGTTATCAGTCGACATGAAATTCTTCTCAGTCGTCACCGTTTTTGTGC
TCGGTCTGCTGGCTGTGGCCAATGCTGTTCCACTGTCGCCCGATCCAGGA
AATGTGATCATCAATGGCGATTGCAGGGTGTGCAATGTCCACGGTGGCAA
GTAGAAGCTTTCTAGACCAT
BS20604.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:42:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
IM1-RA | 138 | CG18108-PA | 1..138 | 17..154 | 690 | 100 | Plus |
IM2-RA | 138 | CG18106-PA | 1..138 | 17..154 | 420 | 87 | Plus |
CG18107-RA | 138 | CG18107-PA | 6..138 | 22..154 | 305 | 82 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:42:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
IM1-RA | 361 | CG18108-RA | 75..212 | 17..154 | 690 | 100 | Plus |
IM2-RA | 367 | CG18106-RA | 72..209 | 17..154 | 420 | 87 | Plus |
CG18107-RA | 281 | CG18107-RA | 76..210 | 22..156 | 315 | 82.2 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:42:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 18384149..18384229 | 74..154 | 405 | 100 | Plus |
2R | 25286936 | 2R | 18384023..18384080 | 17..74 | 290 | 100 | Plus |
2R | 25286936 | 2R | 18386673..18386728 | 17..72 | 220 | 92.9 | Plus |
2R | 25286936 | 2R | 18386792..18386872 | 74..154 | 210 | 84 | Plus |
2R | 25286936 | 2R | 18384758..18384840 | 74..156 | 175 | 80.7 | Plus |
Blast to na_te.dros performed on 2014-11-26 15:42:16 has no hits.
BS20604.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:33 Download gff for
BS20604.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IM1-RA | 72..209 | 17..154 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:56:39 Download gff for
BS20604.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IM1-RA | 75..212 | 17..154 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:18:31 Download gff for
BS20604.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IM1-RA | 75..212 | 17..154 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:18:31 Download gff for
BS20604.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 18384023..18384080 | 17..74 | 100 | -> | Plus |
2R | 18384150..18384229 | 75..154 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:56:39 Download gff for
BS20604.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 14271528..14271585 | 17..74 | 100 | -> | Plus |
arm_2R | 14271655..14271734 | 75..154 | 100 | | Plus |
BS20604.pep Sequence
Translation from 16 to 153
> BS20604.pep
MKFFSVVTVFVLGLLAVANAVPLSPDPGNVIINGDCRVCNVHGGK*
BS20604.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:08:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
IM1-PA | 45 | CG18108-PA | 1..45 | 1..45 | 236 | 100 | Plus |
IM2-PA | 45 | CG18106-PA | 1..45 | 1..45 | 220 | 88.9 | Plus |
CG18107-PA | 45 | CG18107-PA | 1..45 | 1..45 | 202 | 82.2 | Plus |
IM3-PB | 39 | CG16844-PB | 1..37 | 1..41 | 140 | 75.6 | Plus |
IM3-PA | 39 | CG16844-PA | 1..37 | 1..41 | 140 | 75.6 | Plus |