Clone BS20604 Report

Search the DGRC for BS20604

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:206
Well:4
Vector:pDNR-Dual
Associated Gene/TranscriptIM1-RA
Protein status:BS20604.pep: gold
Sequenced Size:170

Clone Sequence Records

BS20604.complete Sequence

170 bp assembled on 2011-01-11

GenBank Submission: KX800897

> BS20604.complete
GAAGTTATCAGTCGACATGAAATTCTTCTCAGTCGTCACCGTTTTTGTGC
TCGGTCTGCTGGCTGTGGCCAATGCTGTTCCACTGTCGCCCGATCCAGGA
AATGTGATCATCAATGGCGATTGCAGGGTGTGCAATGTCCACGGTGGCAA
GTAGAAGCTTTCTAGACCAT

BS20604.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:42:18
Subject Length Description Subject Range Query Range Score Percent Strand
IM1-RA 138 CG18108-PA 1..138 17..154 690 100 Plus
IM2-RA 138 CG18106-PA 1..138 17..154 420 87 Plus
CG18107-RA 138 CG18107-PA 6..138 22..154 305 82 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:42:19
Subject Length Description Subject Range Query Range Score Percent Strand
IM1-RA 361 CG18108-RA 75..212 17..154 690 100 Plus
IM2-RA 367 CG18106-RA 72..209 17..154 420 87 Plus
CG18107-RA 281 CG18107-RA 76..210 22..156 315 82.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:42:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18384149..18384229 74..154 405 100 Plus
2R 25286936 2R 18384023..18384080 17..74 290 100 Plus
2R 25286936 2R 18386673..18386728 17..72 220 92.9 Plus
2R 25286936 2R 18386792..18386872 74..154 210 84 Plus
2R 25286936 2R 18384758..18384840 74..156 175 80.7 Plus
Blast to na_te.dros performed on 2014-11-26 15:42:16 has no hits.

BS20604.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:33 Download gff for BS20604.complete
Subject Subject Range Query Range Percent Splice Strand
IM1-RA 72..209 17..154 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:56:39 Download gff for BS20604.complete
Subject Subject Range Query Range Percent Splice Strand
IM1-RA 75..212 17..154 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:18:31 Download gff for BS20604.complete
Subject Subject Range Query Range Percent Splice Strand
IM1-RA 75..212 17..154 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:18:31 Download gff for BS20604.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18384023..18384080 17..74 100 -> Plus
2R 18384150..18384229 75..154 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:56:39 Download gff for BS20604.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14271528..14271585 17..74 100 -> Plus
arm_2R 14271655..14271734 75..154 100   Plus

BS20604.pep Sequence

Translation from 16 to 153

> BS20604.pep
MKFFSVVTVFVLGLLAVANAVPLSPDPGNVIINGDCRVCNVHGGK*

BS20604.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:08:27
Subject Length Description Subject Range Query Range Score Percent Strand
IM1-PA 45 CG18108-PA 1..45 1..45 236 100 Plus
IM2-PA 45 CG18106-PA 1..45 1..45 220 88.9 Plus
CG18107-PA 45 CG18107-PA 1..45 1..45 202 82.2 Plus
IM3-PB 39 CG16844-PB 1..37 1..41 140 75.6 Plus
IM3-PA 39 CG16844-PA 1..37 1..41 140 75.6 Plus