BS20606.complete Sequence
281 bp assembled on 2011-01-11
GenBank Submission: KX805241
> BS20606.complete
GAAGTTATCAGTCGACATGAAACTGTTGATTTTGGTTTTCGTGTTTGTCG
CTTTTGTGGCCAACGCCTTGGCCCTGAAAAATGCAATCTGTGGTCTACCC
CATTCCCTAAACGGAGATGGCAGAATATCCTGTGAGGCCTATATACCCAG
TTGGTCCTACGACGCCGATCGAAACGAGTGCGTCAAATTTATCTACGGAG
GCTGCGGAGGCAATAACAATAGATTTAATTCGAGGGAAATCTGTGAAGAC
AAGTGTTTGCAATAAAAGCTTTCTAGACCAT
BS20606.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:00:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG16713-RA | 249 | CG16713-PA | 1..249 | 17..265 | 1245 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:00:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG16713-RA | 325 | CG16713-RA | 56..306 | 17..267 | 1255 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:00:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 3695051..3695235 | 267..83 | 925 | 100 | Minus |
2L | 23513712 | 2L | 3695290..3695356 | 83..17 | 335 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 16:00:04 has no hits.
BS20606.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-11 10:33:24 Download gff for
BS20606.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16713-RA | 51..297 | 17..263 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:45:16 Download gff for
BS20606.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16713-RA | 56..302 | 17..263 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:53:57 Download gff for
BS20606.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16713-RA | 56..302 | 17..263 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:53:57 Download gff for
BS20606.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3695055..3695234 | 84..263 | 100 | <- | Minus |
2L | 3695290..3695356 | 17..83 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:45:16 Download gff for
BS20606.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 3695055..3695234 | 84..263 | 100 | <- | Minus |
arm_2L | 3695290..3695356 | 17..83 | 100 | | Minus |
BS20606.pep Sequence
Translation from 16 to 264
> BS20606.pep
MKLLILVFVFVAFVANALALKNAICGLPHSLNGDGRISCEAYIPSWSYDA
DRNECVKFIYGGCGGNNNRFNSREICEDKCLQ*
BS20606.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:55:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG16713-PA | 82 | CG16713-PA | 1..82 | 1..82 | 446 | 100 | Plus |
CG16712-PB | 82 | CG16712-PB | 1..80 | 1..80 | 253 | 56.2 | Plus |
CG16712-PA | 82 | CG16712-PA | 1..80 | 1..80 | 253 | 56.2 | Plus |
Acp24A4-PC | 78 | CG31779-PC | 1..78 | 1..82 | 245 | 57.3 | Plus |
Acp24A4-PB | 78 | CG31779-PB | 1..78 | 1..82 | 245 | 57.3 | Plus |