Clone BS20606 Report

Search the DGRC for BS20606

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:206
Well:6
Vector:pDNR-Dual
Associated Gene/TranscriptCG16713-RA
Protein status:BS20606.pep: full length peptide match
Sequenced Size:281

Clone Sequence Records

BS20606.complete Sequence

281 bp assembled on 2011-01-11

GenBank Submission: KX805241

> BS20606.complete
GAAGTTATCAGTCGACATGAAACTGTTGATTTTGGTTTTCGTGTTTGTCG
CTTTTGTGGCCAACGCCTTGGCCCTGAAAAATGCAATCTGTGGTCTACCC
CATTCCCTAAACGGAGATGGCAGAATATCCTGTGAGGCCTATATACCCAG
TTGGTCCTACGACGCCGATCGAAACGAGTGCGTCAAATTTATCTACGGAG
GCTGCGGAGGCAATAACAATAGATTTAATTCGAGGGAAATCTGTGAAGAC
AAGTGTTTGCAATAAAAGCTTTCTAGACCAT

BS20606.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:00:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG16713-RA 249 CG16713-PA 1..249 17..265 1245 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:00:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG16713-RA 325 CG16713-RA 56..306 17..267 1255 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:00:03
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3695051..3695235 267..83 925 100 Minus
2L 23513712 2L 3695290..3695356 83..17 335 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:00:04 has no hits.

BS20606.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-11 10:33:24 Download gff for BS20606.complete
Subject Subject Range Query Range Percent Splice Strand
CG16713-RA 51..297 17..263 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:45:16 Download gff for BS20606.complete
Subject Subject Range Query Range Percent Splice Strand
CG16713-RA 56..302 17..263 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:53:57 Download gff for BS20606.complete
Subject Subject Range Query Range Percent Splice Strand
CG16713-RA 56..302 17..263 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:53:57 Download gff for BS20606.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3695055..3695234 84..263 100 <- Minus
2L 3695290..3695356 17..83 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:45:16 Download gff for BS20606.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3695055..3695234 84..263 100 <- Minus
arm_2L 3695290..3695356 17..83 100   Minus

BS20606.pep Sequence

Translation from 16 to 264

> BS20606.pep
MKLLILVFVFVAFVANALALKNAICGLPHSLNGDGRISCEAYIPSWSYDA
DRNECVKFIYGGCGGNNNRFNSREICEDKCLQ*

BS20606.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:55:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG16713-PA 82 CG16713-PA 1..82 1..82 446 100 Plus
CG16712-PB 82 CG16712-PB 1..80 1..80 253 56.2 Plus
CG16712-PA 82 CG16712-PA 1..80 1..80 253 56.2 Plus
Acp24A4-PC 78 CG31779-PC 1..78 1..82 245 57.3 Plus
Acp24A4-PB 78 CG31779-PB 1..78 1..82 245 57.3 Plus