Clone BS20736 Report

Search the DGRC for BS20736

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:207
Well:36
Vector:pDNR-Dual
Associated Gene/TranscriptCG9065-RA
Protein status:BS20736.pep: full length peptide match
Sequenced Size:299

Clone Sequence Records

BS20736.complete Sequence

299 bp assembled on 2011-01-18

GenBank Submission: KX803790

> BS20736.complete
GAAGTTATCAGTCGACATGGGCAACAGTGCATCTCAAGGAGTTGCAGCTC
CAAGTGTTTCGGCGGCCCACCCGTTGACCACCGCATCCGCAGCCACCGCA
TCCACAACCACCGCATCCGCAGCCACCGCATCCGGCGAGAAGCCCAAGTG
CAAGGCCTGTTGCGCCTGCCCGGAGACCAAGAGGGCACGTGACGCCTGCA
TTGTGGAGAACGGCGAGGAGAATTGCTTGGCGCTGATAGAGGCGCACAAG
AAGTGCATGCGCGATGCCGGCTTCAATATCTAGAAGCTTTCTAGACCAT

BS20736.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:06:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG9065-RA 267 CG9065-PA 1..267 17..283 1335 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG9065-RA 521 CG9065-RA 103..370 17..284 1340 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:06:20
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15084353..15084534 198..17 910 100 Minus
X 23542271 X 15084180..15084266 284..198 435 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:06:21 has no hits.

BS20736.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:38:28 Download gff for BS20736.complete
Subject Subject Range Query Range Percent Splice Strand
CG9065-RA 59..325 17..283 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:47:56 Download gff for BS20736.complete
Subject Subject Range Query Range Percent Splice Strand
CG9065-RA 103..369 17..283 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:56:23 Download gff for BS20736.complete
Subject Subject Range Query Range Percent Splice Strand
CG9065-RA 103..369 17..283 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:56:23 Download gff for BS20736.complete
Subject Subject Range Query Range Percent Splice Strand
X 15084181..15084265 199..283 100 <- Minus
X 15084353..15084534 17..198 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:47:56 Download gff for BS20736.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 14978214..14978298 199..283 100 <- Minus
arm_X 14978386..14978567 17..198 100   Minus

BS20736.pep Sequence

Translation from 16 to 282

> BS20736.pep
MGNSASQGVAAPSVSAAHPLTTASAATASTTTASAATASGEKPKCKACCA
CPETKRARDACIVENGEENCLALIEAHKKCMRDAGFNI*

BS20736.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:59:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG9065-PA 88 CG9065-PA 1..88 1..88 457 100 Plus