Clone BS20745 Report

Search the DGRC for BS20745

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:207
Well:45
Vector:pDNR-Dual
Associated Gene/TranscriptCG9029-RA
Protein status:BS20745.pep: gold
Sequenced Size:383

Clone Sequence Records

BS20745.complete Sequence

383 bp assembled on 2011-01-18

GenBank Submission: KX801384

> BS20745.complete
GAAGTTATCAGTCGACATGAAATTCTTGACCGTATTTGCATTCGCCTGTG
TGGCAACATTTGTGGTGCTCCACGGCGCCTACGGCTCACCACTGCCGGAG
CCCATTCCCGATCCGAGTCCGGTGGCCGATCCGAGTCCGGCTGCCAATCC
CAGTCCAGTTGCCGATCCGAAGCCCGTTGCCGAGCCATCTGCCAATCCAG
GGACCGGAACCAACGCAGAACCAGGTCCGAGGAGCAAACCGAATCCCAGT
CCCTCGGCACCAGCAACTCTTTTGGAAGCCAATAAGCAAGACAACTTTGC
GGTTCCGCTCCTAGAAACTGCTCCGCAAAAGCTGGATGATGTTCAGGCCG
ATCCCCAGCCGGCTTAGAAGCTTTCTAGACCAT

BS20745.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:12:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG9029-RA 351 CG9029-PA 1..351 17..367 1755 100 Plus
CG9029-RB 369 CG9029-PB 52..369 50..367 1590 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:12:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG9029-RA 543 CG9029-RA 18..369 16..367 1760 100 Plus
CG9029-RB 561 CG9029-RB 70..387 50..367 1590 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:12:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5886118..5886435 50..367 1590 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:12:25 has no hits.

BS20745.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:39:10 Download gff for BS20745.complete
Subject Subject Range Query Range Percent Splice Strand
CG9029-RA 1..351 17..367 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:50:24 Download gff for BS20745.complete
Subject Subject Range Query Range Percent Splice Strand
CG9029-RA 19..369 17..367 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:58:36 Download gff for BS20745.complete
Subject Subject Range Query Range Percent Splice Strand
CG9029-RA 19..369 17..367 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:58:36 Download gff for BS20745.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5886020..5886053 17..50 100 -> Plus
2L 5886119..5886435 51..367 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:50:24 Download gff for BS20745.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5886020..5886053 17..50 100 -> Plus
arm_2L 5886119..5886435 51..367 100   Plus

BS20745.pep Sequence

Translation from 16 to 366

> BS20745.pep
MKFLTVFAFACVATFVVLHGAYGSPLPEPIPDPSPVADPSPAANPSPVAD
PKPVAEPSANPGTGTNAEPGPRSKPNPSPSAPATLLEANKQDNFAVPLLE
TAPQKLDDVQADPQPA*

BS20745.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:02:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG9029-PA 116 CG9029-PA 1..116 1..116 616 100 Plus
CG9029-PB 122 CG9029-PB 1..122 1..116 599 95.1 Plus