BS20750.complete Sequence
371 bp assembled on 2011-01-18
GenBank Submission: KX803587
> BS20750.complete
GAAGTTATCAGTCGACATGTTCAAGATCCTGCTTGTCTGCGCCCTTGTCG
CCCTGGTGGCCGCCAACGAGAATCCCGAGGTCAAGGAGCTGGTCAACGAT
GTCCAAGCCGATGGCTTCGTAAGCAAGTTGGTCCTGGACAACGGTTCCGC
TGCTTCTGCTACCGGAGATGTCCACGGAAACATCGACGGAGTTTTCGAGT
GGGTCTCCCCCGAGGGCGAACACGTCCGTGTGAGCTACAAGGCCGACGAG
AACGGATACCAGCCCCAGAGCGACCTCCTGCCCACTCCTCCTCCAATCCC
AGAGGCCATCCTGAAGGCCATCGCCTACATCCAGGCCCATCCCAGCAAGG
AATAAAAGCTTTCTAGACCAT
BS20750.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:43:03
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Lcp4-RB | 339 | CG2044-PB | 1..339 | 17..355 | 1695 | 100 | Plus |
| Lcp4-RA | 339 | CG2044-PA | 1..339 | 17..355 | 1695 | 100 | Plus |
| Lcp3-RB | 339 | CG2043-PB | 1..333 | 17..349 | 990 | 86.5 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:43:04
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Lcp4-RB | 527 | CG2044-RB | 43..388 | 10..355 | 1700 | 99.4 | Plus |
| Lcp4-RA | 792 | CG2044-RA | 43..388 | 10..355 | 1700 | 99.4 | Plus |
| Lcp3-RB | 730 | CG2043-RB | 180..512 | 17..349 | 990 | 86.5 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:43:01
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 8437765..8438091 | 29..355 | 1635 | 100 | Plus |
| 2R | 25286936 | 2R | 8435557..8435877 | 29..349 | 930 | 86 | Plus |
| 3L | 28110227 | 3L | 10890454..10890525 | 241..312 | 255 | 90.3 | Plus |
| 3L | 28110227 | 3L | 10892254..10892325 | 241..312 | 225 | 87.5 | Plus |
| 3L | 28110227 | 3L | 7086166..7086268 | 344..242 | 185 | 78.6 | Minus |
Blast to na_te.dros performed on 2014-11-26 15:43:02 has no hits.
BS20750.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:34 Download gff for
BS20750.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Lcp4-RA | 45..376 | 22..353 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:56:55 Download gff for
BS20750.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Lcp4-RA | 55..386 | 22..353 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:18:47 Download gff for
BS20750.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Lcp4-RA | 55..386 | 22..353 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:18:47 Download gff for
BS20750.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 8437761..8438089 | 22..353 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:56:55 Download gff for
BS20750.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 4325266..4325594 | 22..353 | 98 | | Plus |
BS20750.pep Sequence
Translation from 16 to 354
> BS20750.pep
MFKILLVCALVALVAANENPEVKELVNDVQADGFVSKLVLDNGSAASATG
DVHGNIDGVFEWVSPEGEHVRVSYKADENGYQPQSDLLPTPPPIPEAILK
AIAYIQAHPSKE*
BS20750.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:08:32
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Lcp4-PB | 112 | CG2044-PB | 1..112 | 1..112 | 577 | 100 | Plus |
| Lcp4-PA | 112 | CG2044-PA | 1..112 | 1..112 | 577 | 100 | Plus |
| Lcp3-PB | 112 | CG2043-PB | 1..111 | 1..111 | 512 | 88.3 | Plus |
| Lcp3-PA | 112 | CG2043-PA | 1..111 | 1..111 | 512 | 88.3 | Plus |
| Lcp1-PB | 130 | CG11650-PB | 1..121 | 1..109 | 310 | 48.8 | Plus |
