Clone BS20758 Report

Search the DGRC for BS20758

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:207
Well:58
Vector:pDNR-Dual
Associated Gene/TranscriptCG18619-RC
Protein status:BS20758.pep: full length peptide match
Sequenced Size:314

Clone Sequence Records

BS20758.complete Sequence

314 bp assembled on 2011-01-18

GenBank Submission: KX803939

> BS20758.complete
GAAGTTATCAGTCGACATGGCTGATATGGAGATACAGAGCAACAAAATGT
CAATAACGGAGGAAACACAAGTGACGCGCAAGGAATGTGGAAAAAGGGGA
CGAAAACCAGGAAGAAAGACGTCTACTGAAAAATTGGACATGAAAGCCAA
ACTAGAACGCAGCAGACAAAGTGCCAGGGAATGCCGGGCGCGCAAGAAGC
TGCGGTATCAGTACCTGGAGGAACTGGTGGCGGATCGGGAGAAGGCTGTA
GTTGCTTTGCGTACGGAACTGGAGCGCGTCGTTAATTCAATGGAATAAAA
GCTTTCTAGACCAT

BS20758.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:12:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG18619-RC 282 CG18619-PC 1..282 17..298 1410 100 Plus
CG18619-RD 285 CG18619-PD 1..285 17..298 1345 98.9 Plus
CG18619-RB 354 CG18619-PB 1..278 17..298 1315 98.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:12:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG18619-RC 516 CG18619-RC 84..365 17..298 1410 100 Plus
CG18619-RD 634 CG18619-RD 84..368 17..298 1345 98.9 Plus
CG18619-RB 627 CG18619-RB 84..361 17..298 1315 98.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:12:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10264762..10264889 154..281 640 100 Plus
2L 23513712 2L 10264551..10264633 73..155 415 100 Plus
2L 23513712 2L 10264208..10264264 17..73 285 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:12:29 has no hits.

BS20758.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:39:10 Download gff for BS20758.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RC 78..357 17..296 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:50:26 Download gff for BS20758.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RC 84..363 17..296 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:58:38 Download gff for BS20758.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RC 84..363 17..296 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:58:38 Download gff for BS20758.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10264208..10264264 17..73 100 -> Plus
2L 10264552..10264633 74..155 100 -> Plus
2L 10264764..10264889 156..281 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:50:26 Download gff for BS20758.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10264552..10264633 74..155 100 -> Plus
arm_2L 10264764..10264889 156..281 100 -> Plus
arm_2L 10264208..10264264 17..73 100 -> Plus

BS20758.pep Sequence

Translation from 16 to 297

> BS20758.pep
MADMEIQSNKMSITEETQVTRKECGKRGRKPGRKTSTEKLDMKAKLERSR
QSARECRARKKLRYQYLEELVADREKAVVALRTELERVVNSME*

BS20758.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:02:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG18619-PC 93 CG18619-PC 1..93 1..93 459 100 Plus
CG18619-PD 94 CG18619-PD 1..94 1..93 447 98.9 Plus
CG18619-PB 117 CG18619-PB 1..89 1..89 435 97.8 Plus
CG18619-PA 118 CG18619-PA 1..90 1..89 423 96.7 Plus