Clone BS20766 Report

Search the DGRC for BS20766

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:207
Well:66
Vector:pDNR-Dual
Associated Gene/TranscriptCG3566-RB
Protein status:BS20766.pep: gold
Sequenced Size:386

Clone Sequence Records

BS20766.complete Sequence

386 bp assembled on 2011-01-18

GenBank Submission: KX804148

> BS20766.complete
GAAGTTATCAGTCGACATGAGCAAGGAAATCCGTTTGGCCACCGTCAACG
AACACAACAAAGCCACGGATCTGTGGGTGGTCATCGACAACAAGGTCTAC
GATGTGACCAAGTTCCGTCTCGAGCATCCCGGTGGCGAGGAATCCCTGGT
GGATGAGGCCGGTCGCGATGCCACCAAGGCCTTCAATGACGTGGGTCACA
GCTCGGAGGCGAGAGAGATGTTGAAGAAATACTACATTGGTGACCTGGCT
GCTGCGGACATCAAGAAGAAAAGCCCAATTAGCTGCCGTCATGTGGCACT
GGCCCTGGGCGCCGCCTTCATCGGCATCTCGCTGGTCTATGTGATCCGAC
GCGGTGTGGCCAGAAACTAGAAGCTTTCTAGACCAT

BS20766.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:13:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG3566-RB 354 CG3566-PB 1..354 17..370 1770 100 Plus
CG3566-RD 321 CG3566-PD 1..266 17..282 1330 100 Plus
CG3566-RC 270 CG3566-PC 1..266 17..282 1330 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:13:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG3566-RB 550 CG3566-RB 86..439 17..370 1770 100 Plus
CG3566-RD 770 CG3566-RD 86..351 17..282 1330 100 Plus
CG3566-RC 1607 CG3566-RC 86..351 17..282 1330 100 Plus
CG3566-RD 770 CG3566-RD 570..659 281..370 450 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:13:22
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6276532..6276639 124..17 540 100 Minus
X 23542271 X 6276370..6276465 213..118 465 99 Minus
X 23542271 X 6275083..6275172 370..281 450 100 Minus
X 23542271 X 6276228..6276298 282..212 355 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:13:23 has no hits.

BS20766.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:39:18 Download gff for BS20766.complete
Subject Subject Range Query Range Percent Splice Strand
CG3566-RB 40..393 17..370 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:50:52 Download gff for BS20766.complete
Subject Subject Range Query Range Percent Splice Strand
CG3566-RB 86..439 17..370 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:59:02 Download gff for BS20766.complete
Subject Subject Range Query Range Percent Splice Strand
CG3566-RB 86..439 17..370 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:59:02 Download gff for BS20766.complete
Subject Subject Range Query Range Percent Splice Strand
X 6275083..6275170 283..370 100 <- Minus
X 6276228..6276296 214..282 100 <- Minus
X 6276370..6276458 125..213 100 <- Minus
X 6276532..6276639 17..124 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:50:52 Download gff for BS20766.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6169116..6169203 283..370 100 <- Minus
arm_X 6170261..6170329 214..282 100 <- Minus
arm_X 6170403..6170491 125..213 100 <- Minus
arm_X 6170565..6170672 17..124 100   Minus

BS20766.pep Sequence

Translation from 16 to 369

> BS20766.pep
MSKEIRLATVNEHNKATDLWVVIDNKVYDVTKFRLEHPGGEESLVDEAGR
DATKAFNDVGHSSEAREMLKKYYIGDLAAADIKKKSPISCRHVALALGAA
FIGISLVYVIRRGVARN*

BS20766.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:02:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG3566-PB 117 CG3566-PB 1..117 1..117 594 100 Plus
CG3566-PD 106 CG3566-PD 1..89 1..89 456 100 Plus
CG3566-PC 89 CG3566-PC 1..88 1..88 452 100 Plus
Cyt-b5-PB 134 CG2140-PB 6..85 2..81 235 52.5 Plus
CG6870-PB 137 CG6870-PB 43..116 4..77 205 52.7 Plus