Clone BS20868 Report

Search the DGRC for BS20868

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:208
Well:68
Vector:pDNR-Dual
Associated Gene/TranscriptCG42371-RA
Protein status:BS20868.pep: full length peptide match
Sequenced Size:296

Clone Sequence Records

BS20868.complete Sequence

296 bp assembled on 2011-01-18

GenBank Submission: KX803965

> BS20868.complete
GAAGTTATCAGTCGACATGCTGCGCAAAACACCAAAACCTGCAATTTGGA
AATTCATCAAAGGAAGTGCCAAAACACTGTTTGTCCTCGAGGCAGTCTGC
TTCGCAGCCAGCTACGGCGTTTATTATCGCATGAACACGAATCGAGAGTT
TCGTCAGCATATTCACGAGAACTATCCCTTCGTTTTGGACTATTACTACA
AAATTGGTGAAATCGTCGGAGACAGCACAGTGCGACAGGCGGATGCGAGT
TATTGGAGTGCTTTGAAGAAAAGCGACTAGAAGCTTTCTAGACCAT

BS20868.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:10:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG42371-RA 264 CG42371-PA 1..264 17..280 1320 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:10:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG42371-RA 691 CG42371-RA 105..369 17..281 1325 100 Plus
CG15386-RA 691 CG15386-RA 105..369 17..281 1325 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:10:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2216825..2216961 281..145 685 100 Minus
2L 23513712 2L 2217013..2217142 146..17 650 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:10:13 has no hits.

BS20868.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:38:54 Download gff for BS20868.complete
Subject Subject Range Query Range Percent Splice Strand
CG15386-RA 90..353 17..280 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:49:26 Download gff for BS20868.complete
Subject Subject Range Query Range Percent Splice Strand
CG15386-RA 105..368 17..280 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:57:45 Download gff for BS20868.complete
Subject Subject Range Query Range Percent Splice Strand
CG15386-RA 105..368 17..280 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:57:45 Download gff for BS20868.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2216826..2216959 147..280 100 <- Minus
2L 2217013..2217142 17..146 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:49:26 Download gff for BS20868.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2216826..2216959 147..280 100 <- Minus
arm_2L 2217013..2217142 17..146 100   Minus

BS20868.pep Sequence

Translation from 16 to 279

> BS20868.pep
MLRKTPKPAIWKFIKGSAKTLFVLEAVCFAASYGVYYRMNTNREFRQHIH
ENYPFVLDYYYKIGEIVGDSTVRQADASYWSALKKSD*

BS20868.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:01:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG42371-PA 87 CG42371-PA 1..87 1..87 465 100 Plus