BS20922.complete Sequence
317 bp assembled on 2011-01-18
GenBank Submission: KX801713
> BS20922.complete
GAAGTTATCAGTCGACATGTCCTATTCCAGCCGATTTGGTTTCGACTTCC
ATCTGCCGGATGAGGGATGGTGCTACCCGAAGAACGACATGCATTTCATC
CGCAGCGCGGAATGGGTGCCCGTGGAGAAGGCAGGCGTGGGCCGCTCATT
CGCCAATCCCAATGGCGTGATCTATCCGCGGGTGGTAGGCATGATTCCAC
GCTACGGCGGCCACGTTCCGGGCAACAAATTTCGTGTGGGCAACACCTAT
GGCCGTTCCACCATCGACGCCAAGCGTCATCTGGCCCTCAATCATGATTG
AAAGCTTTCTAGACCAT
BS20922.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:14:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18336-RB | 285 | CG18336-PB | 1..285 | 17..301 | 1425 | 100 | Plus |
CG18336-RA | 285 | CG18336-PA | 1..285 | 17..301 | 1425 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:14:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18336-RB | 483 | CG18336-RB | 53..339 | 15..301 | 1435 | 100 | Plus |
CG18336-RA | 750 | CG18336-RA | 320..606 | 15..301 | 1435 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:14:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 11293920..11294188 | 301..33 | 1345 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 16:14:40 has no hits.
BS20922.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:39:28 Download gff for
BS20922.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18336-RA | 322..605 | 17..300 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:51:28 Download gff for
BS20922.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18336-RA | 322..605 | 17..300 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:59:32 Download gff for
BS20922.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18336-RA | 322..605 | 17..300 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:59:32 Download gff for
BS20922.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11293921..11294188 | 33..300 | 100 | <- | Minus |
2R | 11294250..11294265 | 17..32 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:51:28 Download gff for
BS20922.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 7181426..7181693 | 33..300 | 100 | <- | Minus |
arm_2R | 7181755..7181770 | 17..32 | 100 | | Minus |
BS20922.pep Sequence
Translation from 16 to 300
> BS20922.pep
MSYSSRFGFDFHLPDEGWCYPKNDMHFIRSAEWVPVEKAGVGRSFANPNG
VIYPRVVGMIPRYGGHVPGNKFRVGNTYGRSTIDAKRHLALNHD*
BS20922.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:03:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18336-PB | 94 | CG18336-PB | 1..94 | 1..94 | 527 | 100 | Plus |
CG18336-PA | 94 | CG18336-PA | 1..94 | 1..94 | 527 | 100 | Plus |