Clone BS20947 Report

Search the DGRC for BS20947

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:209
Well:47
Vector:pDNR-Dual
Associated Gene/TranscriptCG32440-RA
Protein status:BS20947.pep: gold
Sequenced Size:290

Clone Sequence Records

BS20947.complete Sequence

290 bp assembled on 2011-01-18

GenBank Submission: KX801285

> BS20947.complete
GAAGTTATCAGTCGACATGTCATCGCAGTTTCGTGAGAAGCGCGGATTAG
CTAGCAGTGCCAATAATGAACTGCCCACCATGGATCCCAACGAGAGTGAC
TTCGCTCTGGAGCTGAAGCCAGCACCCAAACAGACCTGCATTCCGACGCA
CCAACGCCAGAGATTGGCCAGCTCGGACACCAACGTCTATCAGCGTGAGA
GCGTGTTTGATATACCGGACAAGTCCTGGTCAGTCCTGTACTTTGGATCC
GGCAAGGACAGTTCCTCGAAATAGAAGCTTTCTAGACCAT

BS20947.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:10:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG32440-RA 258 CG32440-PA 1..258 17..274 1290 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:10:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG32440-RA 633 CG32440-RA 185..443 16..274 1295 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:10:33
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21360363..21360530 16..183 840 100 Plus
3L 28110227 3L 21360949..21361039 184..274 455 100 Plus
Blast to na_te.dros performed 2014-11-26 16:10:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 2352..2482 140..263 115 58.8 Plus

BS20947.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:38:57 Download gff for BS20947.complete
Subject Subject Range Query Range Percent Splice Strand
CG32440-RA 186..437 17..268 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:49:37 Download gff for BS20947.complete
Subject Subject Range Query Range Percent Splice Strand
CG32440-RA 186..437 17..268 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:57:55 Download gff for BS20947.complete
Subject Subject Range Query Range Percent Splice Strand
CG32440-RA 186..437 17..268 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:57:55 Download gff for BS20947.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21360949..21361033 184..268 100   Plus
3L 21360364..21360530 17..183 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:49:37 Download gff for BS20947.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21354049..21354133 184..268 100   Plus
arm_3L 21353464..21353630 17..183 100 -> Plus

BS20947.pep Sequence

Translation from 16 to 273

> BS20947.pep
MSSQFREKRGLASSANNELPTMDPNESDFALELKPAPKQTCIPTHQRQRL
ASSDTNVYQRESVFDIPDKSWSVLYFGSGKDSSSK*

BS20947.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:01:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG32440-PA 85 CG32440-PA 1..85 1..85 441 100 Plus