Clone BS21101 Report

Search the DGRC for BS21101

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:211
Well:1
Vector:pDNR-Dual
Associated Gene/TranscriptCG9555-RB
Protein status:BS21101.pep: full length peptide match
Sequenced Size:410

Clone Sequence Records

BS21101.complete Sequence

410 bp assembled on 2011-01-18

GenBank Submission: KX802506

> BS21101.complete
GAAGTTATCAGTCGACATGCGTGACAAAAGTCAGGAGCCATGTTGCCTGC
CACTGAAGGAGGAGTTCCAACGCTCCAAGTTCTCGCTGCATCACGATGAT
CCTGGCGACTTCTGTCGTTCGCAATGGCAGAAGGGCGATCGGAATATCAT
CTGGCTGCTATATCGATGGATCCTGGCTGCTTTTTTCGCAGCGGGTGTGA
TCGGCAGCATGGTTGAAACCTTTAACGGTGGTCGCTGGTTTATTTATCTC
ACGGATTGGGGTTTTTCCCTATGCTTTTATTGCTGTACATATGGCGCCAT
AATCGCCACCATCTACTTCATAAAGCCTTCTTATTTTGCTATTGCTCGTA
GATGTACAAAAACTATTAACAGGCTCCTGGCAGTTGGGCCCTGAAAGCTT
TCTAGACCAT

BS21101.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:07:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG9555-RC 828 CG9555-PC 1..324 17..340 1620 100 Plus
CG9555-RA 828 CG9555-PA 1..324 17..340 1620 100 Plus
CG17906-RA 828 CG17906-PA 28..324 44..340 450 76.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:07:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG9555-RC 1478 CG9555-RC 325..652 13..340 1625 99.7 Plus
CG9555-RA 1246 CG9555-RA 93..420 13..340 1625 99.7 Plus
CG17906-RA 971 CG17906-RA 100..396 44..340 450 76.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:07:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8992059..8992384 13..338 1615 99.7 Plus
2L 23513712 2L 8994490..8994784 44..338 440 76.6 Plus
2L 23513712 2L 8992456..8992491 338..373 180 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:07:20 has no hits.

BS21101.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:38:34 Download gff for BS21101.complete
Subject Subject Range Query Range Percent Splice Strand
CG9555-RB 75..451 17..393 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:48:18 Download gff for BS21101.complete
Subject Subject Range Query Range Percent Splice Strand
CG9555-RA 97..420 17..340 100 == Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:56:45 Download gff for BS21101.complete
Subject Subject Range Query Range Percent Splice Strand
CG9555-RA 97..420 17..340 100 == Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:56:45 Download gff for BS21101.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8992457..8992491 339..373 100 -> Plus
2L 8992691..8992710 374..393 100   Plus
2L 8992063..8992384 17..338 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:48:18 Download gff for BS21101.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8992063..8992384 17..338 100 -> Plus
arm_2L 8992457..8992491 339..373 100 -> Plus
arm_2L 8992691..8992710 374..393 100   Plus

BS21101.pep Sequence

Translation from 16 to 393

> BS21101.pep
MRDKSQEPCCLPLKEEFQRSKFSLHHDDPGDFCRSQWQKGDRNIIWLLYR
WILAAFFAAGVIGSMVETFNGGRWFIYLTDWGFSLCFYCCTYGAIIATIY
FIKPSYFAIARRCTKTINRLLAVGP*

BS21101.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:00:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG9555-PC 275 CG9555-PC 1..108 1..108 614 100 Plus
CG9555-PA 275 CG9555-PA 1..108 1..108 614 100 Plus
CG17906-PA 275 CG17906-PA 1..108 1..108 494 76.9 Plus
CG4480-PC 272 CG4480-PC 18..114 6..104 264 50.5 Plus
CG4480-PB 272 CG4480-PB 18..114 6..104 264 50.5 Plus