Clone BS21313 Report

Search the DGRC for BS21313

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:213
Well:13
Vector:pDNR-Dual
Associated Gene/TranscriptCG8628-RA
Protein status:BS21313.pep: gold
Sequenced Size:287

Clone Sequence Records

BS21313.complete Sequence

287 bp assembled on 2011-01-18

GenBank Submission: KX806001

> BS21313.complete
GAAGTTATCAGTCGACATGGTGTCGTTCGAGGAAGCCACTGAACTCGCCA
ACAAGTTCACCAAGAAGCCCACGGATGCCGAGTTCTTGGAATTCTACGGT
CTCTTCAAGCAGGCCACCGTTGGCGATGTGAACATCGAGAAGCCCGGCGC
TCTGGCTCTCAAGGACAAGGCCAAGTACGAGGCCTGGAGCTCCAACAAGG
GTCTCTCCAAGGAGGCTGCCAAGGAGGCCTACGTAAAGGTGTACGAGAAG
TACGCCCCCAAGTACGCCTAAAAGCTTTCTAGACCAT

BS21313.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:23:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG8628-RA 255 CG8628-PA 1..255 17..271 1275 100 Plus
CG8628-RB 255 CG8628-PB 1..255 17..271 1275 100 Plus
CG8629-RA 255 CG8629-PA 13..255 29..271 825 89.3 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:23:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG8628-RA 429 CG8628-RA 57..313 15..271 1285 100 Plus
CG8628-RB 408 CG8628-RB 36..292 15..271 1285 100 Plus
CG8629-RA 352 CG8629-RA 48..290 29..271 825 89.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:23:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7131143..7131389 25..271 1235 100 Plus
3L 28110227 3L 7127975..7128217 271..29 825 89.3 Minus
Blast to na_te.dros performed on 2014-11-26 16:23:47 has no hits.

BS21313.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:40:41 Download gff for BS21313.complete
Subject Subject Range Query Range Percent Splice Strand
CG8628-RA 59..311 17..269 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:55:34 Download gff for BS21313.complete
Subject Subject Range Query Range Percent Splice Strand
CG8628-RB 38..290 17..269 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:03:19 Download gff for BS21313.complete
Subject Subject Range Query Range Percent Splice Strand
CG8628-RB 38..290 17..269 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:03:19 Download gff for BS21313.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7131134..7131387 18..269 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:55:34 Download gff for BS21313.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7124234..7124487 18..269 98   Plus

BS21313.pep Sequence

Translation from 16 to 270

> BS21313.pep
MVSFEEATELANKFTKKPTDAEFLEFYGLFKQATVGDVNIEKPGALALKD
KAKYEAWSSNKGLSKEAAKEAYVKVYEKYAPKYA*

BS21313.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:01:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG8628-PA 84 CG8628-PA 1..84 1..84 430 100 Plus
CG8628-PB 84 CG8628-PB 1..84 1..84 430 100 Plus
CG8629-PA 84 CG8629-PA 1..84 1..84 366 83.3 Plus
CG15829-PB 82 CG15829-PB 1..81 1..83 219 53 Plus
CG15829-PA 82 CG15829-PA 1..81 1..83 219 53 Plus