Clone BS21318 Report

Search the DGRC for BS21318

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:213
Well:18
Vector:pDNR-Dual
Associated Gene/TranscriptCG34163-RA
Protein status:BS21318.pep: full length peptide match
Sequenced Size:296

Clone Sequence Records

BS21318.complete Sequence

296 bp assembled on 2011-01-18

GenBank Submission: KX806076

> BS21318.complete
GAAGTTATCAGTCGACATGGAAATTAAAAAGTCCAAGAAATCAAAGAACG
ACAAGAAGTCCAAGGCGCCCAAGGAGTCGTCCGTTTCGCTCAAACTGAAC
GCTTTGCATCGCAAGCAAAAGGAAGTCGCCCGCGTGCTCACTTTAAAACA
AGAAATATTACTGAAATCGGGTGTATCCTATCTGGAATATTATGAGATTC
TGGCAGAAATCGAACGACTCAACGGCCTAAAGGAGTCATTTATGCGCCGC
GCTGATAAGCTGAAGCAACAGGACAAATAGAAGCTTTCTAGACCAT

BS21318.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:23:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG34163-RA 264 CG34163-PA 1..264 17..280 1320 100 Plus
CG34163-RB 261 CG34163-PB 13..261 32..280 1245 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:23:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG34163-RA 478 CG34163-RA 49..312 17..280 1320 100 Plus
CG34163-RB 475 CG34163-RB 61..309 32..280 1245 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:23:51
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11988384..11988635 29..280 1260 100 Plus
Blast to na_te.dros performed 2014-11-26 16:23:52
Subject Length Description Subject Range Query Range Score Percent Strand
invader3 5484 invader3 INVADER3 5484bp 3821..3875 3..57 104 70.2 Plus

BS21318.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:40:41 Download gff for BS21318.complete
Subject Subject Range Query Range Percent Splice Strand
CG34163-RA 49..306 17..274 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:55:37 Download gff for BS21318.complete
Subject Subject Range Query Range Percent Splice Strand
CG34163-RA 49..306 17..274 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:03:21 Download gff for BS21318.complete
Subject Subject Range Query Range Percent Splice Strand
CG34163-RA 49..306 17..274 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:03:21 Download gff for BS21318.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11988384..11988629 29..274 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:55:37 Download gff for BS21318.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11988384..11988629 29..274 100   Plus

BS21318.pep Sequence

Translation from 16 to 279

> BS21318.pep
MEIKKSKKSKNDKKSKAPKESSVSLKLNALHRKQKEVARVLTLKQEILLK
SGVSYLEYYEILAEIERLNGLKESFMRRADKLKQQDK*

BS21318.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:01:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG34163-PA 87 CG34163-PA 1..87 1..87 421 100 Plus
CG34163-PB 86 CG34163-PB 1..86 1..87 404 98.9 Plus