BS21318.complete Sequence
296 bp assembled on 2011-01-18
GenBank Submission: KX806076
> BS21318.complete
GAAGTTATCAGTCGACATGGAAATTAAAAAGTCCAAGAAATCAAAGAACG
ACAAGAAGTCCAAGGCGCCCAAGGAGTCGTCCGTTTCGCTCAAACTGAAC
GCTTTGCATCGCAAGCAAAAGGAAGTCGCCCGCGTGCTCACTTTAAAACA
AGAAATATTACTGAAATCGGGTGTATCCTATCTGGAATATTATGAGATTC
TGGCAGAAATCGAACGACTCAACGGCCTAAAGGAGTCATTTATGCGCCGC
GCTGATAAGCTGAAGCAACAGGACAAATAGAAGCTTTCTAGACCAT
BS21318.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:23:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34163-RA | 264 | CG34163-PA | 1..264 | 17..280 | 1320 | 100 | Plus |
CG34163-RB | 261 | CG34163-PB | 13..261 | 32..280 | 1245 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:23:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34163-RA | 478 | CG34163-RA | 49..312 | 17..280 | 1320 | 100 | Plus |
CG34163-RB | 475 | CG34163-RB | 61..309 | 32..280 | 1245 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:23:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 11988384..11988635 | 29..280 | 1260 | 100 | Plus |
Blast to na_te.dros performed 2014-11-26 16:23:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
invader3 | 5484 | invader3 INVADER3 5484bp | 3821..3875 | 3..57 | 104 | 70.2 | Plus |
BS21318.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:40:41 Download gff for
BS21318.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34163-RA | 49..306 | 17..274 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:55:37 Download gff for
BS21318.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34163-RA | 49..306 | 17..274 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:03:21 Download gff for
BS21318.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34163-RA | 49..306 | 17..274 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:03:21 Download gff for
BS21318.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11988384..11988629 | 29..274 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:55:37 Download gff for
BS21318.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 11988384..11988629 | 29..274 | 100 | | Plus |
BS21318.pep Sequence
Translation from 16 to 279
> BS21318.pep
MEIKKSKKSKNDKKSKAPKESSVSLKLNALHRKQKEVARVLTLKQEILLK
SGVSYLEYYEILAEIERLNGLKESFMRRADKLKQQDK*
BS21318.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:01:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34163-PA | 87 | CG34163-PA | 1..87 | 1..87 | 421 | 100 | Plus |
CG34163-PB | 86 | CG34163-PB | 1..86 | 1..87 | 404 | 98.9 | Plus |