Clone BS21320 Report

Search the DGRC for BS21320

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:213
Well:20
Vector:pDNR-Dual
Associated Gene/TranscriptCG34170-RA
Protein status:BS21320.pep: gold
Sequenced Size:221

Clone Sequence Records

BS21320.complete Sequence

221 bp assembled on 2011-01-18

GenBank Submission: KX801159

> BS21320.complete
GAAGTTATCAGTCGACATGGCTGGATCACCTGGCGTTAAGGATAAGCTGA
ATCTGATTGTTGGCGGGGACATTTGCGAGGTATACCGGGATGGATTCAAT
TGCGGATCCTTTGGCTTCTGGTGCGGACTCGTCGGATTGGCCGTCTTCAT
AATTTTTCTCGCCTACTTTCATATAAATCGGGAGCGAATAGATCCGACGT
CATAAAAGCTTTCTAGACCAT

BS21320.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:23:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG34170-RB 189 CG34170-PB 1..189 17..205 945 100 Plus
CG34170-RA 189 CG34170-PA 1..189 17..205 945 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:23:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG34170-RB 353 CG34170-RB 61..250 16..205 950 100 Plus
CG34170-RA 314 CG34170-RA 61..250 16..205 950 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:23:55
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17311571..17311760 205..16 950 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:23:56 has no hits.

BS21320.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:40:42 Download gff for BS21320.complete
Subject Subject Range Query Range Percent Splice Strand
CG34170-RA 62..248 17..203 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:55:40 Download gff for BS21320.complete
Subject Subject Range Query Range Percent Splice Strand
CG34170-RA 62..248 17..203 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:03:23 Download gff for BS21320.complete
Subject Subject Range Query Range Percent Splice Strand
CG34170-RA 62..248 17..203 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:03:23 Download gff for BS21320.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17311573..17311759 17..203 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:55:40 Download gff for BS21320.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 17311573..17311759 17..203 100   Minus

BS21320.pep Sequence

Translation from 16 to 204

> BS21320.pep
MAGSPGVKDKLNLIVGGDICEVYRDGFNCGSFGFWCGLVGLAVFIIFLAY
FHINRERIDPTS*

BS21320.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:01:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG34170-PB 62 CG34170-PB 1..62 1..62 339 100 Plus
CG34170-PA 62 CG34170-PA 1..62 1..62 339 100 Plus