BS21320.complete Sequence
221 bp assembled on 2011-01-18
GenBank Submission: KX801159
> BS21320.complete
GAAGTTATCAGTCGACATGGCTGGATCACCTGGCGTTAAGGATAAGCTGA
ATCTGATTGTTGGCGGGGACATTTGCGAGGTATACCGGGATGGATTCAAT
TGCGGATCCTTTGGCTTCTGGTGCGGACTCGTCGGATTGGCCGTCTTCAT
AATTTTTCTCGCCTACTTTCATATAAATCGGGAGCGAATAGATCCGACGT
CATAAAAGCTTTCTAGACCAT
BS21320.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:23:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34170-RB | 189 | CG34170-PB | 1..189 | 17..205 | 945 | 100 | Plus |
CG34170-RA | 189 | CG34170-PA | 1..189 | 17..205 | 945 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:23:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34170-RB | 353 | CG34170-RB | 61..250 | 16..205 | 950 | 100 | Plus |
CG34170-RA | 314 | CG34170-RA | 61..250 | 16..205 | 950 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:23:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 17311571..17311760 | 205..16 | 950 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 16:23:56 has no hits.
BS21320.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:40:42 Download gff for
BS21320.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34170-RA | 62..248 | 17..203 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:55:40 Download gff for
BS21320.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34170-RA | 62..248 | 17..203 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:03:23 Download gff for
BS21320.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34170-RA | 62..248 | 17..203 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:03:23 Download gff for
BS21320.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 17311573..17311759 | 17..203 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:55:40 Download gff for
BS21320.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 17311573..17311759 | 17..203 | 100 | | Minus |
BS21320.pep Sequence
Translation from 16 to 204
> BS21320.pep
MAGSPGVKDKLNLIVGGDICEVYRDGFNCGSFGFWCGLVGLAVFIIFLAY
FHINRERIDPTS*
BS21320.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:01:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34170-PB | 62 | CG34170-PB | 1..62 | 1..62 | 339 | 100 | Plus |
CG34170-PA | 62 | CG34170-PA | 1..62 | 1..62 | 339 | 100 | Plus |