Clone BS21321 Report

Search the DGRC for BS21321

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:213
Well:21
Vector:pDNR-Dual
Associated Gene/TranscriptCG34175-RA
Protein status:BS21321.pep: full length peptide match
Sequenced Size:293

Clone Sequence Records

BS21321.complete Sequence

293 bp assembled on 2011-01-18

GenBank Submission: KX803576

> BS21321.complete
GAAGTTATCAGTCGACATGGTGTGCCGCTTCAATCCCTTTTACATTGGAC
CAACTCCACCCAGCTGCTGCACGGATTTGAAGTCCGATTGCGATTGCCCG
CCGTGCTCACCGGATACAGGGTATCAGGAGCCTCGACCCGTTCACGAGGA
GTGCAACCCGGGTGTGCCGAAGAAGGAGACCAAGGAGAGCAAGTGCAATC
CTCCTTGCAAAGAAGCCCCCAAAAAGGAAAAGAAGGAGAAGAAGTCCGAG
AATAAAGAGGCTAAAAAAACTAAATAAAAGCTTTCTAGACCAT

BS21321.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:24:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG34175-RA 261 CG34175-PA 1..261 17..277 1305 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:24:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG34175-RA 662 CG34175-RA 113..374 17..278 1310 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:24:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3398135..3398396 17..278 1310 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:24:00 has no hits.

BS21321.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:40:43 Download gff for BS21321.complete
Subject Subject Range Query Range Percent Splice Strand
CG34175-RA 113..358 17..262 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:55:42 Download gff for BS21321.complete
Subject Subject Range Query Range Percent Splice Strand
CG34175-RA 113..358 17..262 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:03:24 Download gff for BS21321.complete
Subject Subject Range Query Range Percent Splice Strand
CG34175-RA 113..358 17..262 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:03:24 Download gff for BS21321.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3398135..3398380 17..262 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:55:42 Download gff for BS21321.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3398135..3398380 17..262 100   Plus

BS21321.pep Sequence

Translation from 16 to 276

> BS21321.pep
MVCRFNPFYIGPTPPSCCTDLKSDCDCPPCSPDTGYQEPRPVHEECNPGV
PKKETKESKCNPPCKEAPKKEKKEKKSENKEAKKTK*

BS21321.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:01:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG34175-PA 86 CG34175-PA 1..86 1..86 502 100 Plus