Clone BS21323 Report

Search the DGRC for BS21323

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:213
Well:23
Vector:pDNR-Dual
Associated Gene/TranscriptCG34203-RA
Protein status:BS21323.pep: gold
Sequenced Size:377

Clone Sequence Records

BS21323.complete Sequence

377 bp assembled on 2011-01-18

GenBank Submission: KX803610

> BS21323.complete
GAAGTTATCAGTCGACATGCGTTGCAACAAGATTATTTTCCAACTTATTG
CCTGTTTTGTGATCATTGAGCTTGTGCTCGGTTATCCCCAAGATCGTTTC
ACATCAGCGGAACAGATTCAACAACTAAGTGATGCCAATGAAGGGGATGC
TCATCCAGAGATCTCTTCCAGCAGTGAAACCCTTAGAAATTTATACAGAT
ACGAGCGCACTCTGAGCAGATTACGAAGAGCTCTGGAGGAGTTGGCCTAT
GAGGAGGCGGCCGATGATATGGAACTGGCCGAGATTAATGTTTTCCGGCC
ACTCTTCCGTTACCGATCTCAGGTGGTGAAGGTGAAGAATCCGCAGCAGC
AGTTTGGTTAAAAGCTTTCTAGACCAT

BS21323.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:23:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG34203-RA 345 CG34203-PA 1..345 17..361 1725 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:23:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG34203-RA 535 CG34203-RA 62..406 17..361 1725 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:23:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21281192..21281523 361..30 1660 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:23:38 has no hits.

BS21323.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:40:40 Download gff for BS21323.complete
Subject Subject Range Query Range Percent Splice Strand
CG34203-RA 62..404 17..359 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:55:30 Download gff for BS21323.complete
Subject Subject Range Query Range Percent Splice Strand
CG34203-RA 62..404 17..359 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:03:16 Download gff for BS21323.complete
Subject Subject Range Query Range Percent Splice Strand
CG34203-RA 62..404 17..359 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:03:16 Download gff for BS21323.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21281194..21281521 32..359 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:55:30 Download gff for BS21323.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17168699..17169026 32..359 100 <- Minus

BS21323.pep Sequence

Translation from 16 to 360

> BS21323.pep
MRCNKIIFQLIACFVIIELVLGYPQDRFTSAEQIQQLSDANEGDAHPEIS
SSSETLRNLYRYERTLSRLRRALEELAYEEAADDMELAEINVFRPLFRYR
SQVVKVKNPQQQFG*

BS21323.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:01:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG34203-PA 114 CG34203-PA 1..114 1..114 575 100 Plus