BS21327.complete Sequence
410 bp assembled on 2011-01-18
GenBank Submission: KX804553
> BS21327.complete
GAAGTTATCAGTCGACATGAGCAGTCAAATTAAAAAGTCCAAAACGACCA
CCAAGAAATTGGTGAAATCATCTCCGAAAGCTCAACTTCCAAAAGCTGCG
GCACAGAATCAAATTTTTAGTTGCCAATTCGAGGTGTTTGGTCATGTGCA
AGGTGTCTTCTTTCGCAAGCACACTCAAAAAAAGGCCATTGAGCTGGGCA
TAACTGGCTGGTGCATGAACACAACTCAAGGAACGGTTCAGGGAATGCTC
GAAGGATCCTTGGACCAAATGACTGATATGAAATACTGGCTGCAGCACAA
GGGAAGTCCTCGTTCGGTGATCGAAAAGGCTGTATTCTCCGAGAATGAAC
CACTGCCCATCAACAACTTTAAGATGTTCTCGATTCGTCGCTAGAAGCTT
TCTAGACCAT
BS21327.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:03:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34161-RC | 378 | CG34161-PC | 1..378 | 17..394 | 1890 | 100 | Plus |
CG34161-RA | 378 | CG34161-PA | 1..378 | 17..394 | 1890 | 100 | Plus |
CG34161-RB | 363 | CG34161-PB | 1..363 | 17..394 | 1630 | 96 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:03:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34161-RC | 563 | CG34161-RC | 66..443 | 17..394 | 1890 | 100 | Plus |
CG34161-RA | 577 | CG34161-RA | 66..443 | 17..394 | 1890 | 100 | Plus |
CG34161-RB | 553 | CG34161-RB | 66..428 | 17..394 | 1630 | 96 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:03:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 10581500..10581637 | 154..17 | 690 | 100 | Minus |
2L | 23513712 | 2L | 10581091..10581205 | 394..280 | 575 | 100 | Minus |
2L | 23513712 | 2L | 10581260..10581372 | 280..168 | 565 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 16:03:12 has no hits.
BS21327.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:38:05 Download gff for
BS21327.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34161-RC | 26..403 | 17..394 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:46:41 Download gff for
BS21327.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34161-RA | 66..443 | 17..394 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:55:13 Download gff for
BS21327.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34161-RA | 66..443 | 17..394 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:55:13 Download gff for
BS21327.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 10581091..10581205 | 280..394 | 100 | <- | Minus |
2L | 10581261..10581370 | 170..279 | 100 | <- | Minus |
2L | 10581424..10581440 | 153..169 | 100 | <- | Minus |
2L | 10581502..10581637 | 17..152 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:46:41 Download gff for
BS21327.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 10581091..10581205 | 280..394 | 100 | <- | Minus |
arm_2L | 10581261..10581370 | 170..279 | 100 | <- | Minus |
arm_2L | 10581424..10581440 | 153..169 | 100 | <- | Minus |
arm_2L | 10581502..10581637 | 17..152 | 100 | | Minus |
BS21327.pep Sequence
Translation from 16 to 393
> BS21327.pep
MSSQIKKSKTTTKKLVKSSPKAQLPKAAAQNQIFSCQFEVFGHVQGVFFR
KHTQKKAIELGITGWCMNTTQGTVQGMLEGSLDQMTDMKYWLQHKGSPRS
VIEKAVFSENEPLPINNFKMFSIRR*
BS21327.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:07:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34161-PC | 125 | CG34161-PC | 1..125 | 1..125 | 651 | 100 | Plus |
CG34161-PA | 125 | CG34161-PA | 1..125 | 1..125 | 651 | 100 | Plus |
CG34161-PB | 120 | CG34161-PB | 1..120 | 1..125 | 607 | 96 | Plus |
CG18371-PA | 110 | CG18371-PA | 7..99 | 32..124 | 250 | 51.6 | Plus |
Acyp2-PB | 102 | CG18505-PB | 9..101 | 32..124 | 245 | 47.3 | Plus |