Clone BS21328 Report

Search the DGRC for BS21328

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:213
Well:28
Vector:pDNR-Dual
Associated Gene/TranscriptCG34172-RA
Protein status:BS21328.pep: full length peptide match
Sequenced Size:221

Clone Sequence Records

BS21328.complete Sequence

221 bp assembled on 2011-01-18

GenBank Submission: KX805035

> BS21328.complete
GAAGTTATCAGTCGACATGGCTCTACCCGATGGACTTTCCAACAAAATGA
AGGTTTTCCAGGCCGTTAACGAGCTGCCCGTTTTTCTGAAAGGCGGACCT
GCGGATAAGATTTTATTTGGCATTACGGCTGGACTGTGTGGCCTTGGCAT
TGTTAGCTTTGTCCACCTGGTCTACACAATGGGATTCGCCAAAAAGAAGG
CCTAAAAGCTTTCTAGACCAT

BS21328.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:03:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG34172-RD 189 CG34172-PD 1..189 17..205 945 100 Plus
CG34172-RC 189 CG34172-PC 1..189 17..205 945 100 Plus
CG34172-RB 189 CG34172-PB 1..189 17..205 945 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:03:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG34172-RD 303 CG34172-RD 68..256 17..205 945 100 Plus
CG34172-RC 866 CG34172-RC 631..819 17..205 945 100 Plus
CG34172-RB 295 CG34172-RB 60..248 17..205 945 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:03:16
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2192572..2192723 205..54 745 99.3 Minus
2L 23513712 2L 2192777..2192822 62..17 230 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:03:17 has no hits.

BS21328.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:38:06 Download gff for BS21328.complete
Subject Subject Range Query Range Percent Splice Strand
CG34172-RA 63..249 17..203 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:46:42 Download gff for BS21328.complete
Subject Subject Range Query Range Percent Splice Strand
CG34172-RB 60..246 17..203 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:55:15 Download gff for BS21328.complete
Subject Subject Range Query Range Percent Splice Strand
CG34172-RB 60..246 17..203 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:55:15 Download gff for BS21328.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2192574..2192715 62..203 100 <- Minus
2L 2192778..2192822 17..61 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:46:42 Download gff for BS21328.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2192574..2192715 62..203 100 <- Minus
arm_2L 2192778..2192822 17..61 100   Minus

BS21328.pep Sequence

Translation from 16 to 204

> BS21328.pep
MALPDGLSNKMKVFQAVNELPVFLKGGPADKILFGITAGLCGLGIVSFVH
LVYTMGFAKKKA*

BS21328.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG34172-PD 62 CG34172-PD 1..62 1..62 317 100 Plus
CG34172-PC 62 CG34172-PC 1..62 1..62 317 100 Plus
CG34172-PB 62 CG34172-PB 1..62 1..62 317 100 Plus
CG34172-PA 62 CG34172-PA 1..62 1..62 317 100 Plus