Clone BS21333 Report

Search the DGRC for BS21333

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:213
Well:33
Vector:pDNR-Dual
Associated Gene/TranscriptCG34228-RA
Protein status:BS21333.pep: full length peptide match
Sequenced Size:299

Clone Sequence Records

BS21333.complete Sequence

299 bp assembled on 2011-01-18

GenBank Submission: KX802164

> BS21333.complete
GAAGTTATCAGTCGACATGTGGCCAATTGTTATGGCTCTAATTAGGCGTA
ACGCCGTTTACATCACGTTGCCCATAGCCGGCGTTGTGGGTTTTATTGGC
TATAACATAGAGAGTTGGATATCTGACAAATACACCCCATACAGTCCATC
CATACAAGAGTTGCGCGCTAAACGGTTGACAGAAGAAAGTTTGAATACAG
ATGCCGCTAATGTGGAAAAATTACGACTGAGTAGTCCCGTACTGGAACGC
AACCTCTCCCCGTCGCTACAGCCCAAGGCCTAAAAGCTTTCTAGACCAT

BS21333.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:03:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG34228-RA 267 CG34228-PA 1..267 17..283 1335 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:03:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG34228-RA 415 CG34228-RA 86..353 17..284 1340 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:03:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11652140..11652277 147..284 690 100 Plus
2R 25286936 2R 11651942..11652071 17..146 650 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:03:56 has no hits.

BS21333.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:38:11 Download gff for BS21333.complete
Subject Subject Range Query Range Percent Splice Strand
CG34228-RA 66..330 17..281 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:46:57 Download gff for BS21333.complete
Subject Subject Range Query Range Percent Splice Strand
CG34228-RA 86..350 17..281 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:55:30 Download gff for BS21333.complete
Subject Subject Range Query Range Percent Splice Strand
CG34228-RA 86..350 17..281 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:55:30 Download gff for BS21333.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11651942..11652071 17..146 100 -> Plus
2R 11652140..11652274 147..281 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:46:57 Download gff for BS21333.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7539447..7539576 17..146 100 -> Plus
arm_2R 7539645..7539779 147..281 100   Plus

BS21333.pep Sequence

Translation from 16 to 282

> BS21333.pep
MWPIVMALIRRNAVYITLPIAGVVGFIGYNIESWISDKYTPYSPSIQELR
AKRLTEESLNTDAANVEKLRLSSPVLERNLSPSLQPKA*

BS21333.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:07:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG34228-PA 88 CG34228-PA 1..88 1..88 445 100 Plus