BS21333.complete Sequence
299 bp assembled on 2011-01-18
GenBank Submission: KX802164
> BS21333.complete
GAAGTTATCAGTCGACATGTGGCCAATTGTTATGGCTCTAATTAGGCGTA
ACGCCGTTTACATCACGTTGCCCATAGCCGGCGTTGTGGGTTTTATTGGC
TATAACATAGAGAGTTGGATATCTGACAAATACACCCCATACAGTCCATC
CATACAAGAGTTGCGCGCTAAACGGTTGACAGAAGAAAGTTTGAATACAG
ATGCCGCTAATGTGGAAAAATTACGACTGAGTAGTCCCGTACTGGAACGC
AACCTCTCCCCGTCGCTACAGCCCAAGGCCTAAAAGCTTTCTAGACCAT
BS21333.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:03:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34228-RA | 267 | CG34228-PA | 1..267 | 17..283 | 1335 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:03:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34228-RA | 415 | CG34228-RA | 86..353 | 17..284 | 1340 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:03:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 11652140..11652277 | 147..284 | 690 | 100 | Plus |
2R | 25286936 | 2R | 11651942..11652071 | 17..146 | 650 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 16:03:56 has no hits.
BS21333.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:38:11 Download gff for
BS21333.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34228-RA | 66..330 | 17..281 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:46:57 Download gff for
BS21333.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34228-RA | 86..350 | 17..281 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:55:30 Download gff for
BS21333.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34228-RA | 86..350 | 17..281 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:55:30 Download gff for
BS21333.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11651942..11652071 | 17..146 | 100 | -> | Plus |
2R | 11652140..11652274 | 147..281 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:46:57 Download gff for
BS21333.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 7539447..7539576 | 17..146 | 100 | -> | Plus |
arm_2R | 7539645..7539779 | 147..281 | 100 | | Plus |
BS21333.pep Sequence
Translation from 16 to 282
> BS21333.pep
MWPIVMALIRRNAVYITLPIAGVVGFIGYNIESWISDKYTPYSPSIQELR
AKRLTEESLNTDAANVEKLRLSSPVLERNLSPSLQPKA*
BS21333.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:07:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34228-PA | 88 | CG34228-PA | 1..88 | 1..88 | 445 | 100 | Plus |