Clone BS21341 Report

Search the DGRC for BS21341

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:213
Well:41
Vector:pDNR-Dual
Associated Gene/TranscriptCG34222-RA
Protein status:BS21341.pep: full length peptide match
Sequenced Size:338

Clone Sequence Records

BS21341.complete Sequence

338 bp assembled on 2011-01-18

GenBank Submission: KX802251

> BS21341.complete
GAAGTTATCAGTCGACATGCGTCATACCCAGAAGGTGCTGACAAGGCTGT
GCCGTTTATCCGCCGGAGGACTTAGACAGAAATGCCGATCCTTCAACCAA
CAAAACTTTAAGCCCAGCATAGCCGACGAGGCTAACAAGCGCCCAACGCA
CTTTCAGTCCATGCGCGAATTCTTTATGCATCCGCTGACCTGGGACCGCA
ATAACGGCTATTTCAATGTGGTTCTGGCTTTGTCCATTTTCGGATTCTGC
TTCTTCAATTCCTGCGCCCCGTGTGAACAGAAGAGGGGTGGCCTTGAGGA
GCGAACCAACCGCCCGCAGTGAAAGCTTTCTAGACCAT

BS21341.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:21:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG34222-RA 306 CG34222-PA 1..306 17..322 1530 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:21:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG34222-RA 584 CG34222-RA 58..365 17..324 1540 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:21:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10320063..10320370 324..17 1540 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:21:48 has no hits.

BS21341.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:40:23 Download gff for BS21341.complete
Subject Subject Range Query Range Percent Splice Strand
CG34222-RA 58..362 17..321 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:54:39 Download gff for BS21341.complete
Subject Subject Range Query Range Percent Splice Strand
CG34222-RA 58..362 17..321 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:02:24 Download gff for BS21341.complete
Subject Subject Range Query Range Percent Splice Strand
CG34222-RA 58..362 17..321 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:02:24 Download gff for BS21341.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10320066..10320370 17..321 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:54:39 Download gff for BS21341.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6207571..6207875 17..321 100   Minus

BS21341.pep Sequence

Translation from 16 to 321

> BS21341.pep
MRHTQKVLTRLCRLSAGGLRQKCRSFNQQNFKPSIADEANKRPTHFQSMR
EFFMHPLTWDRNNGYFNVVLALSIFGFCFFNSCAPCEQKRGGLEERTNRP
Q*

BS21341.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:07:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG34222-PA 101 CG34222-PA 1..101 1..101 554 100 Plus