Clone BS21344 Report

Search the DGRC for BS21344

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:213
Well:44
Vector:pDNR-Dual
Associated Gene/TranscriptCG34267-RA
Protein status:BS21344.pep: full length peptide match
Sequenced Size:266

Clone Sequence Records

BS21344.complete Sequence

266 bp assembled on 2011-01-18

GenBank Submission: KX800844

> BS21344.complete
GAAGTTATCAGTCGACATGTTCCGCATTATCGCTGTGATCTTCGCCCTGG
TAGCAATGGCTTTTGCTGCTCCTGGTTACATTGAGCCCTCCTACGGAGTG
GTTCCTGTAGCCCAAGTGGTGCCCGTGGTGAAATCTGTTCCAGTGGTGCA
GCACGTTCCGGTGGTGAAGAATGTCCCAGTGGTTCAGCATGTCCCTGTGC
TGAAGTCCTACGCTGTTCCCACCTATGGACACCACATCTACCACGGTTAA
AAGCTTTCTAGACCAT

BS21344.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:21:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG34267-RA 234 CG34267-PA 1..234 17..250 1155 99.6 Plus
CG34268-RA 252 CG34268-PA 1..252 17..250 865 90.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:21:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG34267-RA 375 CG34267-RA 79..313 17..251 1160 99.6 Plus
CG34268-RA 373 CG34268-RA 61..313 17..251 870 90.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:21:51
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 500076..500298 251..29 1100 99.6 Minus
3L 28110227 3L 501100..501340 29..251 810 90 Plus
Blast to na_te.dros performed on 2014-11-26 16:21:52 has no hits.

BS21344.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:40:24 Download gff for BS21344.complete
Subject Subject Range Query Range Percent Splice Strand
CG34267-RA 79..305 22..248 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:54:40 Download gff for BS21344.complete
Subject Subject Range Query Range Percent Splice Strand
CG34267-RA 84..310 22..248 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:02:26 Download gff for BS21344.complete
Subject Subject Range Query Range Percent Splice Strand
CG34267-RA 84..310 22..248 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:02:26 Download gff for BS21344.complete
Subject Subject Range Query Range Percent Splice Strand
3L 500079..500304 22..248 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:54:40 Download gff for BS21344.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 500079..500304 22..248 97   Minus

BS21344.pep Sequence

Translation from 16 to 249

> BS21344.pep
MFRIIAVIFALVAMAFAAPGYIEPSYGVVPVAQVVPVVKSVPVVQHVPVV
KNVPVVQHVPVLKSYAVPTYGHHIYHG*

BS21344.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:07:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG34267-PA 77 CG34267-PA 1..77 1..77 397 100 Plus
CG34268-PA 83 CG34268-PA 1..83 1..77 380 92.8 Plus