BS21344.complete Sequence
266 bp assembled on 2011-01-18
GenBank Submission: KX800844
> BS21344.complete
GAAGTTATCAGTCGACATGTTCCGCATTATCGCTGTGATCTTCGCCCTGG
TAGCAATGGCTTTTGCTGCTCCTGGTTACATTGAGCCCTCCTACGGAGTG
GTTCCTGTAGCCCAAGTGGTGCCCGTGGTGAAATCTGTTCCAGTGGTGCA
GCACGTTCCGGTGGTGAAGAATGTCCCAGTGGTTCAGCATGTCCCTGTGC
TGAAGTCCTACGCTGTTCCCACCTATGGACACCACATCTACCACGGTTAA
AAGCTTTCTAGACCAT
BS21344.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:21:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34267-RA | 234 | CG34267-PA | 1..234 | 17..250 | 1155 | 99.6 | Plus |
CG34268-RA | 252 | CG34268-PA | 1..252 | 17..250 | 865 | 90.5 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:21:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34267-RA | 375 | CG34267-RA | 79..313 | 17..251 | 1160 | 99.6 | Plus |
CG34268-RA | 373 | CG34268-RA | 61..313 | 17..251 | 870 | 90.5 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:21:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 500076..500298 | 251..29 | 1100 | 99.6 | Minus |
3L | 28110227 | 3L | 501100..501340 | 29..251 | 810 | 90 | Plus |
Blast to na_te.dros performed on 2014-11-26 16:21:52 has no hits.
BS21344.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:40:24 Download gff for
BS21344.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34267-RA | 79..305 | 22..248 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:54:40 Download gff for
BS21344.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34267-RA | 84..310 | 22..248 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:02:26 Download gff for
BS21344.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34267-RA | 84..310 | 22..248 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:02:26 Download gff for
BS21344.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 500079..500304 | 22..248 | 97 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:54:40 Download gff for
BS21344.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 500079..500304 | 22..248 | 97 | | Minus |
BS21344.pep Sequence
Translation from 16 to 249
> BS21344.pep
MFRIIAVIFALVAMAFAAPGYIEPSYGVVPVAQVVPVVKSVPVVQHVPVV
KNVPVVQHVPVLKSYAVPTYGHHIYHG*
BS21344.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:07:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34267-PA | 77 | CG34267-PA | 1..77 | 1..77 | 397 | 100 | Plus |
CG34268-PA | 83 | CG34268-PA | 1..83 | 1..77 | 380 | 92.8 | Plus |