BS21348.complete Sequence
197 bp assembled on 2011-01-18
GenBank Submission: KX805360
> BS21348.complete
GAAGTTATCAGTCGACATGGACTGCTGCGGTAACGAAGTGCGCAGCGAAA
GTATCCACAACATGCTACAGGCCCTGGTGGACTCAAAGGTGGTCAACGTG
CAGCTTTTGTCGATTGCCGTGGGCATTTTCTTCGTGGTCATGCTGCTGAA
AAACAATTTTCGCAGCTTTTCTGTCACGTAGAAGCTTTCTAGACCAT
BS21348.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:04:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34250-RA | 165 | CG34250-PA | 1..165 | 17..181 | 825 | 100 | Plus |
CG34250-RB | 219 | CG34250-PB | 1..161 | 17..177 | 805 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:04:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34250-RA | 330 | CG34250-RA | 90..255 | 17..182 | 830 | 100 | Plus |
CG34250-RB | 785 | CG34250-RB | 90..250 | 17..177 | 805 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:04:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 17476311..17476476 | 17..182 | 830 | 100 | Plus |
Blast to na_te.dros performed 2014-11-26 16:04:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
HMS-Beagle2 | 7220 | HMS-Beagle2 Beagle2 7220bp | 4837..4870 | 125..92 | 98 | 76.5 | Minus |
BS21348.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:38:13 Download gff for
BS21348.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34250-RA | 23..187 | 17..181 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:47:03 Download gff for
BS21348.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34250-RA | 90..254 | 17..181 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:55:36 Download gff for
BS21348.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34250-RA | 90..254 | 17..181 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:55:36 Download gff for
BS21348.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 17476311..17476475 | 17..181 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:47:03 Download gff for
BS21348.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 17469411..17469575 | 17..181 | 100 | | Plus |
BS21348.pep Sequence
Translation from 16 to 180
> BS21348.pep
MDCCGNEVRSESIHNMLQALVDSKVVNVQLLSIAVGIFFVVMLLKNNFRS
FSVT*
BS21348.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:07:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34250-PA | 54 | CG34250-PA | 1..54 | 1..54 | 268 | 100 | Plus |
CG34250-PB | 72 | CG34250-PB | 1..54 | 1..54 | 268 | 100 | Plus |