Clone BS21348 Report

Search the DGRC for BS21348

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:213
Well:48
Vector:pDNR-Dual
Associated Gene/TranscriptCG34250-RA
Protein status:BS21348.pep: full length peptide match
Sequenced Size:197

Clone Sequence Records

BS21348.complete Sequence

197 bp assembled on 2011-01-18

GenBank Submission: KX805360

> BS21348.complete
GAAGTTATCAGTCGACATGGACTGCTGCGGTAACGAAGTGCGCAGCGAAA
GTATCCACAACATGCTACAGGCCCTGGTGGACTCAAAGGTGGTCAACGTG
CAGCTTTTGTCGATTGCCGTGGGCATTTTCTTCGTGGTCATGCTGCTGAA
AAACAATTTTCGCAGCTTTTCTGTCACGTAGAAGCTTTCTAGACCAT

BS21348.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:04:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG34250-RA 165 CG34250-PA 1..165 17..181 825 100 Plus
CG34250-RB 219 CG34250-PB 1..161 17..177 805 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:04:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG34250-RA 330 CG34250-RA 90..255 17..182 830 100 Plus
CG34250-RB 785 CG34250-RB 90..250 17..177 805 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:04:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17476311..17476476 17..182 830 100 Plus
Blast to na_te.dros performed 2014-11-26 16:04:12
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle2 7220 HMS-Beagle2 Beagle2 7220bp 4837..4870 125..92 98 76.5 Minus

BS21348.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:38:13 Download gff for BS21348.complete
Subject Subject Range Query Range Percent Splice Strand
CG34250-RA 23..187 17..181 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:47:03 Download gff for BS21348.complete
Subject Subject Range Query Range Percent Splice Strand
CG34250-RA 90..254 17..181 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:55:36 Download gff for BS21348.complete
Subject Subject Range Query Range Percent Splice Strand
CG34250-RA 90..254 17..181 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:55:36 Download gff for BS21348.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17476311..17476475 17..181 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:47:03 Download gff for BS21348.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17469411..17469575 17..181 100   Plus

BS21348.pep Sequence

Translation from 16 to 180

> BS21348.pep
MDCCGNEVRSESIHNMLQALVDSKVVNVQLLSIAVGIFFVVMLLKNNFRS
FSVT*

BS21348.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:07:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG34250-PA 54 CG34250-PA 1..54 1..54 268 100 Plus
CG34250-PB 72 CG34250-PB 1..54 1..54 268 100 Plus