Clone BS21360 Report

Search the DGRC for BS21360

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:213
Well:60
Vector:pDNR-Dual
Associated Gene/TranscriptCG34280-RA
Protein status:BS21360.pep: gold
Sequenced Size:281

Clone Sequence Records

BS21360.complete Sequence

281 bp assembled on 2011-01-18

GenBank Submission: KX800961

> BS21360.complete
GAAGTTATCAGTCGACATGAAGTTGATCATCCTGATCGCTTTTTTGGCTC
TTCTTAATCTAGCGAAATCACAGAACTGTAACAATGATTGCTCGAGAATC
GGAATTAATTTCCTTTGCGGGAAAACTGTGAGGAATGGCAGGGAAATACG
CTGTACCTATAGGAATCCTTGCGAAATGCATTTGCATGCCTGCCAGAAAC
GGGAGGAGTGGAGAAAAGATACAACAGGTCGATGCACACGCGACTCGGAG
GAATGCAGACGGTAGAAGCTTTCTAGACCAT

BS21360.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:22:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG34280-RA 249 CG34280-PA 1..249 17..265 1245 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:22:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG34280-RA 376 CG34280-RA 16..266 15..265 1255 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:21:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17403512..17403703 206..15 960 100 Minus
3R 32079331 3R 17403382..17403441 265..206 300 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:22:00 has no hits.

BS21360.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:40:25 Download gff for BS21360.complete
Subject Subject Range Query Range Percent Splice Strand
CG34280-RA 18..266 17..265 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:54:44 Download gff for BS21360.complete
Subject Subject Range Query Range Percent Splice Strand
CG34280-RA 18..266 17..265 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:02:30 Download gff for BS21360.complete
Subject Subject Range Query Range Percent Splice Strand
CG34280-RA 18..266 17..265 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:02:30 Download gff for BS21360.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17403382..17403440 207..265 100 <- Minus
3R 17403512..17403701 17..206 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:54:44 Download gff for BS21360.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13229104..13229162 207..265 100 <- Minus
arm_3R 13229234..13229423 17..206 100   Minus

BS21360.pep Sequence

Translation from 16 to 264

> BS21360.pep
MKLIILIAFLALLNLAKSQNCNNDCSRIGINFLCGKTVRNGREIRCTYRN
PCEMHLHACQKREEWRKDTTGRCTRDSEECRR*

BS21360.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:07:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG34280-PA 82 CG34280-PA 1..82 1..82 452 100 Plus