Clone BS21365 Report

Search the DGRC for BS21365

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:213
Well:65
Vector:pDNR-Dual
Associated Gene/TranscriptCG34301-RA
Protein status:BS21365.pep: gold
Sequenced Size:290

Clone Sequence Records

BS21365.complete Sequence

290 bp assembled on 2011-01-18

GenBank Submission: KX804099

> BS21365.complete
GAAGTTATCAGTCGACATGGGTCACCTGCAGTTGGATTTCCATTCCATAC
CTAAGCTCCATGGCAGGGAGAACTATTGGCAGTGGCGCATCCTCCTGAAG
ACCTTTCTGGAGGCCAACGATCTGTGGAAGCACAACGAACCGAAGGAGAG
CCCAGAAACCAAATTCCTGATTTTGGCCAGCGTTACGGCCGATAAGATTG
AGCCATCCTACGATGATCAAAGCTGTTCGTACATTTTCCAAAACATGGAG
AGTCGATTCGGGCCTTTTAGTTAAAAGCTTTCTAGACCAT

BS21365.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:23:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG34301-RA 258 CG34301-PA 1..258 17..274 1290 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:23:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG34301-RA 307 CG34301-RA 6..269 13..276 1305 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:23:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8773440..8773575 13..148 665 99.3 Plus
3R 32079331 3R 8773643..8773772 147..276 650 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:23:09 has no hits.

BS21365.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:40:36 Download gff for BS21365.complete
Subject Subject Range Query Range Percent Splice Strand
CG34301-RA 10..265 17..272 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:55:20 Download gff for BS21365.complete
Subject Subject Range Query Range Percent Splice Strand
CG34301-RA 10..265 17..272 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:03:03 Download gff for BS21365.complete
Subject Subject Range Query Range Percent Splice Strand
CG34301-RA 10..265 17..272 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:03:03 Download gff for BS21365.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8773444..8773575 17..148 100 -> Plus
3R 8773645..8773768 149..272 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:55:20 Download gff for BS21365.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4599166..4599297 17..148 100 -> Plus
arm_3R 4599367..4599490 149..272 100   Plus

BS21365.pep Sequence

Translation from 16 to 273

> BS21365.pep
MGHLQLDFHSIPKLHGRENYWQWRILLKTFLEANDLWKHNEPKESPETKF
LILASVTADKIEPSYDDQSCSYIFQNMESRFGPFS*

BS21365.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:00:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG34301-PA 85 CG34301-PA 1..85 1..85 467 100 Plus
CG42446-PA 123 CG42446-PA 39..109 11..81 169 42.3 Plus