Clone BS21368 Report

Search the DGRC for BS21368

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:213
Well:68
Vector:pDNR-Dual
Associated Gene/TranscriptCG42246-RA
Protein status:BS21368.pep: full length peptide match
Sequenced Size:302

Clone Sequence Records

BS21368.complete Sequence

302 bp assembled on 2011-01-18

GenBank Submission: KX806172

> BS21368.complete
GAAGTTATCAGTCGACATGGCTTTTCTTTTTAAACTATTTACCTTCTTGG
CGGTGGCCGCCATTTTGATCCAAATGACACTTGCACTGGAGTTTATGGAT
GAAGACTTTCTGGCAAACGATGACGGTCATCACTTGGACGAAGAGTCCGC
TGAAGTGCCTGGTATTTTGACTGGTTATACCAGAGATACGATCGCTCACT
TTAATCCTCGCAAAGTAGATGGGGGATTTCGACAATTGTGGGAACGTGTT
CCCCTTCAAAAAGTCGATGATATTAAGCGGAGATAGAAGCTTTCTAGACC
AT

BS21368.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:23:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG42246-RB 270 CG42246-PB 1..270 17..286 1350 100 Plus
CG42246-RA 270 CG42246-PA 1..270 17..286 1350 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:23:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG42246-RB 387 CG42246-RB 70..340 16..286 1355 100 Plus
CG42246-RA 578 CG42246-RA 70..340 16..286 1355 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:23:13
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7411505..7411715 286..76 1055 100 Minus
X 23542271 X 7411777..7411837 76..16 305 100 Minus
Blast to na_te.dros performed 2014-11-26 16:23:14
Subject Length Description Subject Range Query Range Score Percent Strand
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 3915..3979 121..59 121 69.2 Minus

BS21368.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:40:37 Download gff for BS21368.complete
Subject Subject Range Query Range Percent Splice Strand
CG42246-RA 86..340 32..286 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:55:21 Download gff for BS21368.complete
Subject Subject Range Query Range Percent Splice Strand
CG42246-RA 86..340 32..286 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:03:05 Download gff for BS21368.complete
Subject Subject Range Query Range Percent Splice Strand
CG42246-RA 86..340 32..286 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:03:05 Download gff for BS21368.complete
Subject Subject Range Query Range Percent Splice Strand
X 7411505..7411714 77..286 100 <- Minus
X 7411777..7411821 32..76 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:55:21 Download gff for BS21368.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7305538..7305747 77..286 100 <- Minus
arm_X 7305810..7305854 32..76 100   Minus

BS21368.pep Sequence

Translation from 16 to 285

> BS21368.pep
MAFLFKLFTFLAVAAILIQMTLALEFMDEDFLANDDGHHLDEESAEVPGI
LTGYTRDTIAHFNPRKVDGGFRQLWERVPLQKVDDIKRR*

BS21368.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:00:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG42246-PB 89 CG42246-PB 1..89 1..89 462 100 Plus
CG42246-PA 89 CG42246-PA 1..89 1..89 462 100 Plus