BS21370.complete Sequence
332 bp assembled on 2011-01-18
GenBank Submission: KX800920
> BS21370.complete
GAAGTTATCAGTCGACATGAAATTCACGATAATCGTTTTTGTTGCGCTCC
TCGCCTTTGCATCGGCCCAGTTCGGTCCGTTTGGTCAAATTATTAGGGGT
ATTGAACGATTTGAAGGTGGTCTGCAACAACAACAGCAGCAGCAGCAAAG
CGGCTTTGGCGGTGGTCAGCAGCAGCAACAGCAGGAGGAGGGTGTCATCT
TCAGAGGTCCTTTCGGCGGCGGAGTGGAGTTCTTCCAGGAGCAACAGCAG
CAGCAGCAAGGCGGTGGAGGTCAGCAGCAACAGCAGCAGGAGAACCTATT
TAACTTCTTCGGCTAAAAGCTTTCTAGACCAT
BS21370.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:23:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34165-RB | 300 | CG34165-PB | 1..300 | 17..316 | 1500 | 100 | Plus |
CG34165-RA | 300 | CG34165-PA | 1..300 | 17..316 | 1500 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:23:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34165-RB | 686 | CG34165-RB | 78..380 | 15..317 | 1515 | 100 | Plus |
CG34165-RA | 515 | CG34165-RA | 78..380 | 15..317 | 1515 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:23:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 14713931..14714220 | 28..317 | 1450 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 16:23:06 has no hits.
BS21370.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:40:36 Download gff for
BS21370.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34165-RA | 53..350 | 17..314 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:55:18 Download gff for
BS21370.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34165-RA | 80..377 | 17..314 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:03:01 Download gff for
BS21370.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34165-RA | 80..377 | 17..314 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:03:01 Download gff for
BS21370.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 14713927..14714217 | 23..314 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:55:18 Download gff for
BS21370.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 14713927..14714217 | 23..314 | 99 | | Plus |
BS21370.pep Sequence
Translation from 16 to 315
> BS21370.pep
MKFTIIVFVALLAFASAQFGPFGQIIRGIERFEGGLQQQQQQQQSGFGGG
QQQQQQEEGVIFRGPFGGGVEFFQEQQQQQQGGGGQQQQQQENLFNFFG*
BS21370.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:00:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34165-PB | 99 | CG34165-PB | 1..99 | 1..99 | 514 | 100 | Plus |
CG34165-PA | 99 | CG34165-PA | 1..99 | 1..99 | 514 | 100 | Plus |
CG31775-PB | 89 | CG31775-PB | 1..87 | 1..92 | 183 | 51.5 | Plus |
CG31775-PA | 89 | CG31775-PA | 1..87 | 1..92 | 183 | 51.5 | Plus |
CG42586-PB | 89 | CG42586-PB | 1..87 | 1..92 | 183 | 51.5 | Plus |