BS21373.complete Sequence
287 bp assembled on 2011-01-18
GenBank Submission: KX806520
> BS21373.complete
GAAGTTATCAGTCGACATGGCTATGGCTAATGTGGACAAAGGTGAACTTA
TGGACCAGGTTAAGCAACAGATTGCTGTTGCGAATGCCCAGGAATTGCTC
ACGCAAATGACCGAAAAGTGCTTCAAAAAATGTGTCAATAAGCCGGGAAC
TTCCCTCGATTCGTCCGAACAGAAATGCATTTCCATGTGCATGGACCGGT
TTATGGACTCGTGGAACCTCATTTCTCGGGTGTACGGCCAAAGAATACAA
CGTGAACAATCCAAGTTCTAAAAGCTTTCTAGACCAT
BS21373.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:23:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34132-RA | 255 | CG34132-PA | 1..255 | 17..271 | 1275 | 100 | Plus |
Tim13-RA | 279 | CG11611-PA | 17..200 | 33..216 | 260 | 76.1 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:23:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34132-RA | 535 | CG34132-RA | 147..402 | 17..272 | 1280 | 100 | Plus |
Tim13-RA | 442 | CG11611-RA | 106..289 | 33..216 | 260 | 76.1 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:23:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 7885649..7885804 | 17..172 | 780 | 100 | Plus |
2L | 23513712 | 2L | 7885875..7885976 | 171..272 | 510 | 100 | Plus |
3L | 28110227 | 3L | 11774213..11774396 | 216..33 | 260 | 76.1 | Minus |
Blast to na_te.dros performed on 2014-11-26 16:23:25 has no hits.
BS21373.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:40:38 Download gff for
BS21373.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34132-RA | 1..253 | 17..269 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:55:26 Download gff for
BS21373.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34132-RA | 147..399 | 17..269 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:03:11 Download gff for
BS21373.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34132-RA | 147..399 | 17..269 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:03:11 Download gff for
BS21373.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 7885649..7885804 | 17..172 | 100 | -> | Plus |
2L | 7885877..7885973 | 173..269 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:55:26 Download gff for
BS21373.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 7885649..7885804 | 17..172 | 100 | -> | Plus |
arm_2L | 7885877..7885973 | 173..269 | 100 | | Plus |
BS21373.pep Sequence
Translation from 16 to 270
> BS21373.pep
MAMANVDKGELMDQVKQQIAVANAQELLTQMTEKCFKKCVNKPGTSLDSS
EQKCISMCMDRFMDSWNLISRVYGQRIQREQSKF*
BS21373.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:01:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34132-PA | 84 | CG34132-PA | 1..84 | 1..84 | 435 | 100 | Plus |
Tim13-PA | 92 | CG11611-PA | 1..81 | 1..81 | 350 | 76.5 | Plus |
CG42302-PA | 121 | CG42302-PA | 8..77 | 12..81 | 175 | 44.3 | Plus |
Tim8-PB | 88 | CG1728-PB | 20..82 | 15..79 | 135 | 38.5 | Plus |
Tim8-PA | 88 | CG1728-PA | 20..82 | 15..79 | 135 | 38.5 | Plus |