Clone BS21373 Report

Search the DGRC for BS21373

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:213
Well:73
Vector:pDNR-Dual
Associated Gene/TranscriptCG34132-RA
Protein status:BS21373.pep: full length peptide match
Sequenced Size:287

Clone Sequence Records

BS21373.complete Sequence

287 bp assembled on 2011-01-18

GenBank Submission: KX806520

> BS21373.complete
GAAGTTATCAGTCGACATGGCTATGGCTAATGTGGACAAAGGTGAACTTA
TGGACCAGGTTAAGCAACAGATTGCTGTTGCGAATGCCCAGGAATTGCTC
ACGCAAATGACCGAAAAGTGCTTCAAAAAATGTGTCAATAAGCCGGGAAC
TTCCCTCGATTCGTCCGAACAGAAATGCATTTCCATGTGCATGGACCGGT
TTATGGACTCGTGGAACCTCATTTCTCGGGTGTACGGCCAAAGAATACAA
CGTGAACAATCCAAGTTCTAAAAGCTTTCTAGACCAT

BS21373.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:23:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG34132-RA 255 CG34132-PA 1..255 17..271 1275 100 Plus
Tim13-RA 279 CG11611-PA 17..200 33..216 260 76.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:23:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG34132-RA 535 CG34132-RA 147..402 17..272 1280 100 Plus
Tim13-RA 442 CG11611-RA 106..289 33..216 260 76.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:23:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7885649..7885804 17..172 780 100 Plus
2L 23513712 2L 7885875..7885976 171..272 510 100 Plus
3L 28110227 3L 11774213..11774396 216..33 260 76.1 Minus
Blast to na_te.dros performed on 2014-11-26 16:23:25 has no hits.

BS21373.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:40:38 Download gff for BS21373.complete
Subject Subject Range Query Range Percent Splice Strand
CG34132-RA 1..253 17..269 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:55:26 Download gff for BS21373.complete
Subject Subject Range Query Range Percent Splice Strand
CG34132-RA 147..399 17..269 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:03:11 Download gff for BS21373.complete
Subject Subject Range Query Range Percent Splice Strand
CG34132-RA 147..399 17..269 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:03:11 Download gff for BS21373.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7885649..7885804 17..172 100 -> Plus
2L 7885877..7885973 173..269 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:55:26 Download gff for BS21373.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7885649..7885804 17..172 100 -> Plus
arm_2L 7885877..7885973 173..269 100   Plus

BS21373.pep Sequence

Translation from 16 to 270

> BS21373.pep
MAMANVDKGELMDQVKQQIAVANAQELLTQMTEKCFKKCVNKPGTSLDSS
EQKCISMCMDRFMDSWNLISRVYGQRIQREQSKF*

BS21373.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:01:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG34132-PA 84 CG34132-PA 1..84 1..84 435 100 Plus
Tim13-PA 92 CG11611-PA 1..81 1..81 350 76.5 Plus
CG42302-PA 121 CG42302-PA 8..77 12..81 175 44.3 Plus
Tim8-PB 88 CG1728-PB 20..82 15..79 135 38.5 Plus
Tim8-PA 88 CG1728-PA 20..82 15..79 135 38.5 Plus