Clone BS21381 Report

Search the DGRC for BS21381

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:213
Well:81
Vector:pDNR-Dual
Associated Gene/TranscriptCG34234-RA
Protein status:BS21381.pep: gold
Sequenced Size:407

Clone Sequence Records

BS21381.complete Sequence

407 bp assembled on 2011-01-18

GenBank Submission: KX806106

> BS21381.complete
GAAGTTATCAGTCGACATGAGACGATGCAAGACAATTCAAATGCTGTTCC
TCTGTTTGATGATGAGAATGCGAGAAAGTCATGAGCGGCCCACGCCGAAA
AATCTGCTGGAACAAATGCTGCCTGCTGACACCTTTGACGTTATCCGGAG
AATACCTCGCTCCGATGAACCCGGTCCGGATGCCAAAGGGGACCTGAAGC
TGTTGCATGCTCCCTGCGAGTTTGACTTGATAAGATACACATCGATTAAC
CACTATCCCATTTATTGCCTGCCCGTCTACACAAATCGGCACGTGAACGA
GGACTGGTATCGACTTTATAGGACCTACGACACCGAGGGATTTGTTTTCG
GGCAGTTTTACGAGCGTCTCCAGCGGTACGAGTTGGACTGAAAGCTTTCT
AGACCAT

BS21381.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG34234-RA 351 CG34234-PA 1..351 41..391 1755 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG34234-RA 603 CG34234-RA 11..387 16..392 1885 100 Plus
Dh44-R2-RB 3069 CG12370-RB 2018..2349 392..61 1660 100 Minus
Dh44-R2-RB 3069 CG12370-RB 2406..2451 61..16 230 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:03:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12486935..12487266 392..61 1660 100 Minus
2R 25286936 2R 12487323..12487368 61..16 230 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:03:46 has no hits.

BS21381.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:38:09 Download gff for BS21381.complete
Subject Subject Range Query Range Percent Splice Strand
CG34234-RA 12..385 17..390 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:46:53 Download gff for BS21381.complete
Subject Subject Range Query Range Percent Splice Strand
CG34234-RA 12..385 17..390 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:55:26 Download gff for BS21381.complete
Subject Subject Range Query Range Percent Splice Strand
CG34234-RA 12..385 17..390 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:55:26 Download gff for BS21381.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12486937..12487265 62..390 100 <- Minus
2R 12487323..12487367 17..61 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:46:53 Download gff for BS21381.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8374828..8374872 17..61 100   Minus
arm_2R 8374442..8374770 62..390 100 <- Minus

BS21381.pep Sequence

Translation from 16 to 390

> BS21381.pep
MRRCKTIQMLFLCLMMRMRESHERPTPKNLLEQMLPADTFDVIRRIPRSD
EPGPDAKGDLKLLHAPCEFDLIRYTSINHYPIYCLPVYTNRHVNEDWYRL
YRTYDTEGFVFGQFYERLQRYELD*

BS21381.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:07:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG34234-PA 116 CG34234-PA 1..116 9..124 640 100 Plus
CG30270-PD 78 CG30270-PD 4..70 59..124 174 46.3 Plus
CG30270-PC 78 CG30270-PC 4..70 59..124 174 46.3 Plus