BS21383.complete Sequence
266 bp assembled on 2011-01-18
GenBank Submission: KX803043
> BS21383.complete
GAAGTTATCAGTCGACATGTGGCCCAACTTTTTGGCTGTCGTTTCCCTAC
TGTGCCTTGCATTCTTCGCTTGGGCAAAAGCTGGACCTGTGCCAATTGTG
AATGAGCACCAACAATTGATGCCGAAAGTGCCTCAATGGCACTGCCTGCG
CTACTTTAAGCATGATGTCCTGATGATGCGCCGCTGTCGCCACTTGCGAG
TCCCTACAGCGCCACGACTGGGCGATGTCCTCAAGCGAAAGAAGAAATAG
AAGCTTTCTAGACCAT
BS21383.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:23:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34136-RA | 234 | CG34136-PA | 1..234 | 17..250 | 1170 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:23:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34136-RA | 706 | CG34136-RA | 268..501 | 17..250 | 1170 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:23:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 21098582..21098727 | 105..250 | 730 | 100 | Plus |
2L | 23513712 | 2L | 21097189..21097278 | 17..106 | 450 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 16:23:18 has no hits.
BS21383.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:40:37 Download gff for
BS21383.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34136-RA | 268..488 | 17..237 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:55:23 Download gff for
BS21383.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34136-RA | 268..488 | 17..237 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:03:07 Download gff for
BS21383.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34136-RA | 268..488 | 17..237 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:03:07 Download gff for
BS21383.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 21097189..21097278 | 17..106 | 100 | -> | Plus |
2L | 21098584..21098714 | 107..237 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:55:23 Download gff for
BS21383.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 21097189..21097278 | 17..106 | 100 | -> | Plus |
arm_2L | 21098584..21098714 | 107..237 | 100 | | Plus |
BS21383.pep Sequence
Translation from 16 to 249
> BS21383.pep
MWPNFLAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK*
BS21383.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:00:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34136-PA | 77 | CG34136-PA | 1..77 | 1..77 | 427 | 100 | Plus |