Clone BS21383 Report

Search the DGRC for BS21383

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:213
Well:83
Vector:pDNR-Dual
Associated Gene/TranscriptCG34136-RA
Protein status:BS21383.pep: full length peptide match
Sequenced Size:266

Clone Sequence Records

BS21383.complete Sequence

266 bp assembled on 2011-01-18

GenBank Submission: KX803043

> BS21383.complete
GAAGTTATCAGTCGACATGTGGCCCAACTTTTTGGCTGTCGTTTCCCTAC
TGTGCCTTGCATTCTTCGCTTGGGCAAAAGCTGGACCTGTGCCAATTGTG
AATGAGCACCAACAATTGATGCCGAAAGTGCCTCAATGGCACTGCCTGCG
CTACTTTAAGCATGATGTCCTGATGATGCGCCGCTGTCGCCACTTGCGAG
TCCCTACAGCGCCACGACTGGGCGATGTCCTCAAGCGAAAGAAGAAATAG
AAGCTTTCTAGACCAT

BS21383.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:23:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG34136-RA 234 CG34136-PA 1..234 17..250 1170 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:23:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG34136-RA 706 CG34136-RA 268..501 17..250 1170 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:23:17
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21098582..21098727 105..250 730 100 Plus
2L 23513712 2L 21097189..21097278 17..106 450 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:23:18 has no hits.

BS21383.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:40:37 Download gff for BS21383.complete
Subject Subject Range Query Range Percent Splice Strand
CG34136-RA 268..488 17..237 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:55:23 Download gff for BS21383.complete
Subject Subject Range Query Range Percent Splice Strand
CG34136-RA 268..488 17..237 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:03:07 Download gff for BS21383.complete
Subject Subject Range Query Range Percent Splice Strand
CG34136-RA 268..488 17..237 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:03:07 Download gff for BS21383.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21097189..21097278 17..106 100 -> Plus
2L 21098584..21098714 107..237 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:55:23 Download gff for BS21383.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 21097189..21097278 17..106 100 -> Plus
arm_2L 21098584..21098714 107..237 100   Plus

BS21383.pep Sequence

Translation from 16 to 249

> BS21383.pep
MWPNFLAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKK*

BS21383.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:00:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG34136-PA 77 CG34136-PA 1..77 1..77 427 100 Plus