Clone BS21384 Report

Search the DGRC for BS21384

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:213
Well:84
Vector:pDNR-Dual
Associated Gene/TranscriptRpb12-RA
Protein status:BS21384.pep: full length peptide match
Sequenced Size:206

Clone Sequence Records

BS21384.complete Sequence

206 bp assembled on 2011-01-18

GenBank Submission: KX805187

> BS21384.complete
GAAGTTATCAGTCGACATGTCGGAAACTAGCTCCAAGGATAATGTCAAAA
CGGCAATGACCTATATTTGTGGAGAATGCCATCATGAAAACGAAATGCGC
CCCAGGGATCCGATTCGTTGTCGCGAGTGTGGATATCGTATCATGTACAA
AAAGCGCACCAAGCGTCTTGTTGTCTTTGATGCCCGTTAAAAGCTTTCTA
GACCAT

BS21384.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:23:22
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb12-RA 174 CG34186-PA 1..174 17..190 870 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:23:23
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb12-RA 353 CG34186-RA 80..255 17..192 880 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:23:20
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15145179..15145273 167..73 475 100 Minus
2R 25286936 2R 15145383..15145440 74..17 290 100 Minus
Blast to na_te.dros performed 2014-11-26 16:23:21
Subject Length Description Subject Range Query Range Score Percent Strand
297 6995 297 DMIS297 6995bp Derived from X03431 (g8146) (Rel. 36, Last updated, Version 2). 2945..2982 90..53 100 73.7 Minus

BS21384.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:40:38 Download gff for BS21384.complete
Subject Subject Range Query Range Percent Splice Strand
CG34186-RA 59..230 17..188 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:55:25 Download gff for BS21384.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb12-RA 80..251 17..188 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:03:09 Download gff for BS21384.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb12-RA 80..251 17..188 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:03:09 Download gff for BS21384.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15145070..15145090 168..188 100 <- Minus
2R 15145179..15145271 75..167 100 <- Minus
2R 15145383..15145440 17..74 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:55:25 Download gff for BS21384.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11032575..11032595 168..188 100 <- Minus
arm_2R 11032684..11032776 75..167 100 <- Minus
arm_2R 11032888..11032945 17..74 100   Minus

BS21384.pep Sequence

Translation from 16 to 189

> BS21384.pep
MSETSSKDNVKTAMTYICGECHHENEMRPRDPIRCRECGYRIMYKKRTKR
LVVFDAR*

BS21384.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:01:00
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb12-PA 57 CG34186-PA 1..57 1..57 313 100 Plus