BS21384.complete Sequence
206 bp assembled on 2011-01-18
GenBank Submission: KX805187
> BS21384.complete
GAAGTTATCAGTCGACATGTCGGAAACTAGCTCCAAGGATAATGTCAAAA
CGGCAATGACCTATATTTGTGGAGAATGCCATCATGAAAACGAAATGCGC
CCCAGGGATCCGATTCGTTGTCGCGAGTGTGGATATCGTATCATGTACAA
AAAGCGCACCAAGCGTCTTGTTGTCTTTGATGCCCGTTAAAAGCTTTCTA
GACCAT
BS21384.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:23:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Rpb12-RA | 174 | CG34186-PA | 1..174 | 17..190 | 870 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:23:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Rpb12-RA | 353 | CG34186-RA | 80..255 | 17..192 | 880 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:23:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 15145179..15145273 | 167..73 | 475 | 100 | Minus |
2R | 25286936 | 2R | 15145383..15145440 | 74..17 | 290 | 100 | Minus |
Blast to na_te.dros performed 2014-11-26 16:23:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
297 | 6995 | 297 DMIS297 6995bp Derived from X03431 (g8146) (Rel. 36, Last updated, Version 2). | 2945..2982 | 90..53 | 100 | 73.7 | Minus |
BS21384.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:40:38 Download gff for
BS21384.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34186-RA | 59..230 | 17..188 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:55:25 Download gff for
BS21384.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Rpb12-RA | 80..251 | 17..188 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:03:09 Download gff for
BS21384.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Rpb12-RA | 80..251 | 17..188 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:03:09 Download gff for
BS21384.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 15145070..15145090 | 168..188 | 100 | <- | Minus |
2R | 15145179..15145271 | 75..167 | 100 | <- | Minus |
2R | 15145383..15145440 | 17..74 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:55:25 Download gff for
BS21384.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 11032575..11032595 | 168..188 | 100 | <- | Minus |
arm_2R | 11032684..11032776 | 75..167 | 100 | <- | Minus |
arm_2R | 11032888..11032945 | 17..74 | 100 | | Minus |
BS21384.pep Sequence
Translation from 16 to 189
> BS21384.pep
MSETSSKDNVKTAMTYICGECHHENEMRPRDPIRCRECGYRIMYKKRTKR
LVVFDAR*
BS21384.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:01:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Rpb12-PA | 57 | CG34186-PA | 1..57 | 1..57 | 313 | 100 | Plus |