Clone BS21386 Report

Search the DGRC for BS21386

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:213
Well:86
Vector:pDNR-Dual
Associated Gene/TranscriptCG34229-RA
Protein status:BS21386.pep: full length peptide match
Sequenced Size:305

Clone Sequence Records

BS21386.complete Sequence

305 bp assembled on 2011-01-18

GenBank Submission: KX801903

> BS21386.complete
GAAGTTATCAGTCGACATGTCCAAGTTACCAAAAGCATCACTTAGTTTGA
AGCAGTTTATGCTGCGCCAGGAAGTACTGAAGCTCTACCGGGAAATATTT
CGAACGATTCGTCAGGTTCCCGACAAAAACAGCCAGCTGGAGCTAAAATC
CTGGGCACGGCATGACTTCCAGACGAATCGCCATCAAAGTGACGAGGTGG
CCATCAAGATGCTCCTTCAGCACGGCAGACGCAGCCTCACAGAACTAAGG
ACCAGCCTCCAACTGAGCGGGGTGAGCGAGGGCAAATAGAAGCTTTCTAG
ACCAT

BS21386.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:03:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG34229-RA 273 CG34229-PA 1..273 17..289 1365 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:03:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG34229-RA 474 CG34229-RA 117..389 17..289 1365 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:03:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11841844..11842079 54..289 1180 100 Plus
2R 25286936 2R 11841724..11841762 17..55 195 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:03:26 has no hits.

BS21386.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:38:07 Download gff for BS21386.complete
Subject Subject Range Query Range Percent Splice Strand
CG34229-RA 117..383 17..283 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:46:45 Download gff for BS21386.complete
Subject Subject Range Query Range Percent Splice Strand
CG34229-RA 117..383 17..283 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:55:19 Download gff for BS21386.complete
Subject Subject Range Query Range Percent Splice Strand
CG34229-RA 117..383 17..283 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:55:19 Download gff for BS21386.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11841724..11841762 17..55 100 -> Plus
2R 11841846..11842073 56..283 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:46:45 Download gff for BS21386.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7729229..7729267 17..55 100 -> Plus
arm_2R 7729351..7729578 56..283 100   Plus

BS21386.pep Sequence

Translation from 16 to 288

> BS21386.pep
MSKLPKASLSLKQFMLRQEVLKLYREIFRTIRQVPDKNSQLELKSWARHD
FQTNRHQSDEVAIKMLLQHGRRSLTELRTSLQLSGVSEGK*

BS21386.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:07:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG34229-PA 90 CG34229-PA 1..90 1..90 448 100 Plus