Clone BS21389 Report

Search the DGRC for BS21389

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:213
Well:89
Vector:pDNR-Dual
Associated Gene/TranscriptCG34264-RB
Protein status:BS21389.pep: full length peptide match
Sequenced Size:386

Clone Sequence Records

BS21389.complete Sequence

386 bp assembled on 2011-01-18

GenBank Submission: KX805936

> BS21389.complete
GAAGTTATCAGTCGACATGGCGCGTTCCCAGTCGAAAATGATTCGGGCCG
CCATGGTCGTGGACGACCCTAATATGGTGGCCTGGCTGCCATACCTTAAC
TTTCTTCGCTTTCTGAAGCGAAACTTCTATCCCAGGACTGATTTGCGCCG
CTTACTTCAGGTGGGACTCATCCGTTGGATCGCACTTAGCGATGCCCAGA
AGAGGTTATTTGAGCCAGAACGAATCCTGGCGCGTGTGGCTCGCAGGCAA
AGGAATAAACGACGCCGCCGACTACTTCGCCGTGCTCGGCATGGCCAGAA
AGGACGTGGTGCAGTGCGACGCCCCATCTACGACAGCCGTCCTAAACCGC
GACGCCGCAAACCGAAGTAGAAGCTTTCTAGACCAT

BS21389.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:03:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG34264-RC 354 CG34264-PC 1..354 17..370 1770 100 Plus
CG34264-RB 354 CG34264-PB 1..354 17..370 1770 100 Plus
CG34264-RD 345 CG34264-PD 1..339 17..371 1500 95.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:03:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG34264-RC 563 CG34264-RC 125..479 17..371 1775 100 Plus
CG34264-RB 587 CG34264-RB 122..476 17..371 1775 100 Plus
CG34264-RD 547 CG34264-RD 125..463 17..371 1500 95.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:03:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 317208..317411 17..220 1020 100 Plus
3L 28110227 3L 317465..317615 221..371 755 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:03:30 has no hits.

BS21389.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:38:07 Download gff for BS21389.complete
Subject Subject Range Query Range Percent Splice Strand
CG34264-RB 122..475 17..370 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:46:48 Download gff for BS21389.complete
Subject Subject Range Query Range Percent Splice Strand
CG34264-RB 122..475 17..370 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:55:21 Download gff for BS21389.complete
Subject Subject Range Query Range Percent Splice Strand
CG34264-RB 122..475 17..370 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:55:21 Download gff for BS21389.complete
Subject Subject Range Query Range Percent Splice Strand
3L 317208..317411 17..220 100 -> Plus
3L 317465..317614 221..370 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:46:48 Download gff for BS21389.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 317208..317411 17..220 100 -> Plus
arm_3L 317465..317614 221..370 100   Plus

BS21389.pep Sequence

Translation from 16 to 369

> BS21389.pep
MARSQSKMIRAAMVVDDPNMVAWLPYLNFLRFLKRNFYPRTDLRRLLQVG
LIRWIALSDAQKRLFEPERILARVARRQRNKRRRRLLRRARHGQKGRGAV
RRPIYDSRPKPRRRKPK*

BS21389.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:07:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG34264-PC 117 CG34264-PC 1..117 1..117 601 100 Plus
CG34264-PB 117 CG34264-PB 1..117 1..117 601 100 Plus
CG34264-PD 114 CG34264-PD 1..62 1..62 318 100 Plus