Clone BS21393 Report

Search the DGRC for BS21393

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:213
Well:93
Vector:pDNR-Dual
Associated Gene/TranscriptCG34247-RA
Protein status:BS21393.pep: gold
Sequenced Size:284

Clone Sequence Records

BS21393.complete Sequence

284 bp assembled on 2011-01-18

GenBank Submission: KX803147

> BS21393.complete
GAAGTTATCAGTCGACATGAAGCTGCTGATCTTTGCCTGTTTGCTTGCTC
TGGCTTTGGGGCACGAGGTGTATTACTATACCCCCAGCTATGGGTACTAC
CCCAGTACCTTTGCCAGGTCCTCGGCTGTCCTGCCCTTGGCCTATTCCCG
TTTGATTGCCCCGGCAGCCGCCGAATCGCATCTTTACCACAGCGTGGAGA
CCCCGAACTCCTTCCAGCAGCAATATCGCAGCGACTACAAGCCCCTGACC
TATGAGTACATCTACTAGAAGCTTTCTAGACCAT

BS21393.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:22:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG34247-RA 252 CG34247-PA 1..252 17..268 1260 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:22:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG34247-RA 353 CG34247-RA 30..282 17..269 1265 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:22:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16261256..16261500 269..25 1225 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:22:39 has no hits.

BS21393.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:40:32 Download gff for BS21393.complete
Subject Subject Range Query Range Percent Splice Strand
CG34247-RA 30..281 17..268 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:55:07 Download gff for BS21393.complete
Subject Subject Range Query Range Percent Splice Strand
CG34247-RA 30..281 17..268 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:02:50 Download gff for BS21393.complete
Subject Subject Range Query Range Percent Splice Strand
CG34247-RA 30..281 17..268 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:02:50 Download gff for BS21393.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16261257..16261505 17..268 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:55:07 Download gff for BS21393.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16254357..16254605 17..268 98   Minus

BS21393.pep Sequence

Translation from 16 to 267

> BS21393.pep
MKLLIFACLLALALGHEVYYYTPSYGYYPSTFARSSAVLPLAYSRLIAPA
AAESHLYHSVETPNSFQQQYRSDYKPLTYEYIY*

BS21393.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:07:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG34247-PA 83 CG34247-PA 1..83 1..83 437 100 Plus