BS21440.complete Sequence
185 bp assembled on 2011-01-18
GenBank Submission: KX806147
> BS21440.complete
GAAGTTATCAGTCGACATGAAGTGGCTTAGTTTGTTCCTGGTATTCGGCA
TCCTCGGACTCATCGGCAGTCTGGGCACTTTAGCCCTAGCGGAACCCAAT
CCGGAGCCCAAGGGTCGTCCGCACACAACGCGACGTCCTCGAAACGATAA
CGACAACGATCGACGCTAGAAGCTTTCTAGACCAT
BS21440.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:24:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34208-RA | 153 | CG34208-PA | 1..153 | 17..169 | 765 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:24:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34208-RA | 380 | CG34208-RA | 23..179 | 13..169 | 770 | 99.4 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:24:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 22333148..22333304 | 13..169 | 770 | 99.4 | Plus |
Blast to na_te.dros performed on 2014-11-26 16:24:30 has no hits.
BS21440.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:40:47 Download gff for
BS21440.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34208-RA | 27..179 | 17..169 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:55:55 Download gff for
BS21440.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34208-RA | 27..179 | 17..169 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:03:38 Download gff for
BS21440.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34208-RA | 27..179 | 17..169 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:03:38 Download gff for
BS21440.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 22333152..22333304 | 17..169 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:55:55 Download gff for
BS21440.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 18220657..18220809 | 17..169 | 100 | | Plus |
BS21440.pep Sequence
Translation from 16 to 168
> BS21440.pep
MKWLSLFLVFGILGLIGSLGTLALAEPNPEPKGRPHTTRRPRNDNDNDRR
*
BS21440.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:01:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34208-PA | 50 | CG34208-PA | 1..50 | 1..50 | 268 | 100 | Plus |