Clone BS21440 Report

Search the DGRC for BS21440

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:214
Well:40
Vector:pDNR-Dual
Associated Gene/TranscriptCG34208-RA
Protein status:BS21440.pep: gold
Sequenced Size:185

Clone Sequence Records

BS21440.complete Sequence

185 bp assembled on 2011-01-18

GenBank Submission: KX806147

> BS21440.complete
GAAGTTATCAGTCGACATGAAGTGGCTTAGTTTGTTCCTGGTATTCGGCA
TCCTCGGACTCATCGGCAGTCTGGGCACTTTAGCCCTAGCGGAACCCAAT
CCGGAGCCCAAGGGTCGTCCGCACACAACGCGACGTCCTCGAAACGATAA
CGACAACGATCGACGCTAGAAGCTTTCTAGACCAT

BS21440.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:24:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG34208-RA 153 CG34208-PA 1..153 17..169 765 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:24:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG34208-RA 380 CG34208-RA 23..179 13..169 770 99.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:24:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22333148..22333304 13..169 770 99.4 Plus
Blast to na_te.dros performed on 2014-11-26 16:24:30 has no hits.

BS21440.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:40:47 Download gff for BS21440.complete
Subject Subject Range Query Range Percent Splice Strand
CG34208-RA 27..179 17..169 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:55:55 Download gff for BS21440.complete
Subject Subject Range Query Range Percent Splice Strand
CG34208-RA 27..179 17..169 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:03:38 Download gff for BS21440.complete
Subject Subject Range Query Range Percent Splice Strand
CG34208-RA 27..179 17..169 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:03:38 Download gff for BS21440.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22333152..22333304 17..169 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:55:55 Download gff for BS21440.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18220657..18220809 17..169 100   Plus

BS21440.pep Sequence

Translation from 16 to 168

> BS21440.pep
MKWLSLFLVFGILGLIGSLGTLALAEPNPEPKGRPHTTRRPRNDNDNDRR
*

BS21440.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:01:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG34208-PA 50 CG34208-PA 1..50 1..50 268 100 Plus