BS21469.complete Sequence
248 bp assembled on 2011-01-18
GenBank Submission: KX802444
> BS21469.complete
GAAGTTATCAGTCGACATGTCCAACAACAAGGCATCCTCTTCCCGAGGCC
GACATCCTGGGATGCAGTTCAGCACTGCCATGGGAACGCCGGAAACCAAG
CGCAAGATGCTTCTCTATAGACGATTATTGTGCCGTGAGTTGGCACGTGA
CGGGAAAACTCCCCGGGAGATCGCAAGGGCTAGAAATCTAACGCTTCAAG
AGCAGGATCAGGGCAGGTTTCCGAAGTCCTGAAAGCTTTCTAGACCAT
BS21469.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:00:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34160-RA | 216 | CG34160-PA | 1..216 | 17..232 | 1080 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:00:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34160-RA | 497 | CG34160-RA | 153..369 | 17..233 | 1085 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:00:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 10579997..10580196 | 34..233 | 1000 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 16:00:56 has no hits.
BS21469.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:37:47 Download gff for
BS21469.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34160-RA | 97..311 | 17..231 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:45:39 Download gff for
BS21469.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34160-RA | 153..367 | 17..231 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:54:20 Download gff for
BS21469.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34160-RA | 153..367 | 17..231 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:54:20 Download gff for
BS21469.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 10579905..10579921 | 17..33 | 100 | -> | Plus |
2L | 10579997..10580194 | 34..231 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:45:39 Download gff for
BS21469.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 10579905..10579921 | 17..33 | 100 | -> | Plus |
arm_2L | 10579997..10580194 | 34..231 | 100 | | Plus |
BS21469.pep Sequence
Translation from 16 to 231
> BS21469.pep
MSNNKASSSRGRHPGMQFSTAMGTPETKRKMLLYRRLLCRELARDGKTPR
EIARARNLTLQEQDQGRFPKS*
BS21469.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:05:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34160-PA | 71 | CG34160-PA | 1..71 | 1..71 | 365 | 100 | Plus |