Clone BS21469 Report

Search the DGRC for BS21469

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:214
Well:69
Vector:pDNR-Dual
Associated Gene/TranscriptCG34160-RA
Protein status:BS21469.pep: full length peptide match
Sequenced Size:248

Clone Sequence Records

BS21469.complete Sequence

248 bp assembled on 2011-01-18

GenBank Submission: KX802444

> BS21469.complete
GAAGTTATCAGTCGACATGTCCAACAACAAGGCATCCTCTTCCCGAGGCC
GACATCCTGGGATGCAGTTCAGCACTGCCATGGGAACGCCGGAAACCAAG
CGCAAGATGCTTCTCTATAGACGATTATTGTGCCGTGAGTTGGCACGTGA
CGGGAAAACTCCCCGGGAGATCGCAAGGGCTAGAAATCTAACGCTTCAAG
AGCAGGATCAGGGCAGGTTTCCGAAGTCCTGAAAGCTTTCTAGACCAT

BS21469.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:00:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG34160-RA 216 CG34160-PA 1..216 17..232 1080 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:00:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG34160-RA 497 CG34160-RA 153..369 17..233 1085 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:00:55
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10579997..10580196 34..233 1000 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:00:56 has no hits.

BS21469.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:37:47 Download gff for BS21469.complete
Subject Subject Range Query Range Percent Splice Strand
CG34160-RA 97..311 17..231 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:45:39 Download gff for BS21469.complete
Subject Subject Range Query Range Percent Splice Strand
CG34160-RA 153..367 17..231 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:54:20 Download gff for BS21469.complete
Subject Subject Range Query Range Percent Splice Strand
CG34160-RA 153..367 17..231 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:54:20 Download gff for BS21469.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10579905..10579921 17..33 100 -> Plus
2L 10579997..10580194 34..231 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:45:39 Download gff for BS21469.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10579905..10579921 17..33 100 -> Plus
arm_2L 10579997..10580194 34..231 100   Plus

BS21469.pep Sequence

Translation from 16 to 231

> BS21469.pep
MSNNKASSSRGRHPGMQFSTAMGTPETKRKMLLYRRLLCRELARDGKTPR
EIARARNLTLQEQDQGRFPKS*

BS21469.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:05:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG34160-PA 71 CG34160-PA 1..71 1..71 365 100 Plus