Clone BS21476 Report

Search the DGRC for BS21476

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:214
Well:76
Vector:pDNR-Dual
Associated Gene/TranscriptCG34221-RB
Protein status:BS21476.pep: full length peptide match
Sequenced Size:362

Clone Sequence Records

BS21476.complete Sequence

362 bp assembled on 2011-01-18

GenBank Submission: KX805836

> BS21476.complete
GAAGTTATCAGTCGACATGCATTTGCCCCAAGGAGCATTAAGCTTTCTGT
TCATCACTTGCATGATGTTCGCACTGGCAGGCGGCCATCCATCAAGCGAC
AAGCTGAAGATCCGAATACACGTGCCGGTGAAGCACCACACACATGTACA
CACGAAGACGGTCATTAAGAAGGTTCCGCTGCCCATTCCGGTGCCGGTCA
AGGAGCACCACCACGAGCCGAAGAAGCACCACAGCAGCCGCAGCCATCAC
CATCACCACCACCACGACGACGACCAGGATGACGATTTCGAGGGCTACGA
GTACCCCATCAAGGCCAAGCGGCGCACGCGGCATCCCTTTGTCTGAAAGC
TTTCTAGACCAT

BS21476.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:01:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG34221-RC 330 CG34221-PC 1..330 17..346 1650 100 Plus
CG34221-RB 330 CG34221-PB 1..330 17..346 1650 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:01:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG34221-RC 1165 CG34221-RC 129..458 17..346 1650 100 Plus
CG34221-RB 752 CG34221-RB 129..458 17..346 1650 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:00:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10197843..10198080 346..109 1190 100 Minus
2R 25286936 2R 10198372..10198446 109..35 375 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:01:00 has no hits.

BS21476.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:37:48 Download gff for BS21476.complete
Subject Subject Range Query Range Percent Splice Strand
CG34221-RB 109..437 17..345 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:45:42 Download gff for BS21476.complete
Subject Subject Range Query Range Percent Splice Strand
CG34221-RB 109..437 17..345 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:54:22 Download gff for BS21476.complete
Subject Subject Range Query Range Percent Splice Strand
CG34221-RB 129..457 17..345 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:54:22 Download gff for BS21476.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10197844..10198080 109..345 100 <- Minus
2R 10198373..10198446 35..108 100 <- Minus
2R 10199566..10199583 17..34 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:45:42 Download gff for BS21476.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6085349..6085585 109..345 100 <- Minus
arm_2R 6085878..6085951 35..108 100 <- Minus
arm_2R 6087071..6087088 17..34 100   Minus

BS21476.pep Sequence

Translation from 16 to 345

> BS21476.pep
MHLPQGALSFLFITCMMFALAGGHPSSDKLKIRIHVPVKHHTHVHTKTVI
KKVPLPIPVPVKEHHHEPKKHHSSRSHHHHHHHDDDQDDDFEGYEYPIKA
KRRTRHPFV*

BS21476.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:05:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG34221-PC 109 CG34221-PC 1..109 1..109 619 100 Plus
CG34221-PB 109 CG34221-PB 1..109 1..109 619 100 Plus