Clone BS21502 Report

Search the DGRC for BS21502

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:215
Well:2
Vector:pDNR-Dual
Associated Gene/TranscriptCG34305-RA
Protein status:BS21502.pep: full length peptide match
Sequenced Size:272

Clone Sequence Records

BS21502.complete Sequence

272 bp assembled on 2011-01-18

GenBank Submission: KX802711

> BS21502.complete
GAAGTTATCAGTCGACATGAAGATACTCAACTTCATAATCCTGCTAGTCC
TGGTGACCATCGCTCTATCAGCCCCCGCTGCCGCCACAGACAATGCTCCT
ACGGTATCCGTGCTGCGCTACAAAGATGATCGGGATTTGGCTAATATTCA
GCGGGCAATTATTGCGCAGTACGAAAGAATTGGCGGCACCACTAAGGTTC
ATCAGCCACTGACGGCCAATATCGTCAACCCAGCAAGCCTTGGAATTGTC
ATTTAAAAGCTTTCTAGACCAT

BS21502.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:01:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG34305-RA 240 CG34305-PA 1..240 17..256 1200 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:01:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG34305-RA 300 CG34305-RA 11..250 17..256 1200 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:01:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4242835..4243059 256..32 1125 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:01:31 has no hits.

BS21502.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:37:52 Download gff for BS21502.complete
Subject Subject Range Query Range Percent Splice Strand
CG34305-RA 11..248 17..254 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:45:55 Download gff for BS21502.complete
Subject Subject Range Query Range Percent Splice Strand
CG34305-RA 11..248 17..254 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:54:34 Download gff for BS21502.complete
Subject Subject Range Query Range Percent Splice Strand
CG34305-RA 11..248 17..254 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:54:34 Download gff for BS21502.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4242837..4243059 32..254 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:45:55 Download gff for BS21502.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 68559..68781 32..254 100 <- Minus

BS21502.pep Sequence

Translation from 16 to 255

> BS21502.pep
MKILNFIILLVLVTIALSAPAAATDNAPTVSVLRYKDDRDLANIQRAIIA
QYERIGGTTKVHQPLTANIVNPASLGIVI*

BS21502.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:05:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG34305-PA 79 CG34305-PA 1..79 1..79 382 100 Plus