Clone BS21516 Report

Search the DGRC for BS21516

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:215
Well:16
Vector:pDNR-Dual
Associated Gene/TranscriptAcp53C14c-RA
Protein status:BS21516.pep: full length peptide match
Sequenced Size:407

Clone Sequence Records

BS21516.complete Sequence

407 bp assembled on 2011-01-18

GenBank Submission: KX800843

> BS21516.complete
GAAGTTATCAGTCGACATGAAGTCCAAACAAGTCTTTTACATCGCCTTCA
GCTTGCTTCTGCTGGGATCCTTGCTGCCAAACGAAGTGGAGTCCTTAAGA
GTAGATCTTAATAAGCTGGCGGAGTGCACAGAATCGGGATTGAAAGTAGC
CACAACGTTGCTCGTGAGGGCGATACCATGTGTAAAAAAATTGGCAAAAT
GTGCTGACTTTCGAGCCATTAAGACTAAGGACCTTGATATTACCGCACTT
GCCCTCTTGGGCTATCAATATCTGCAAACGGTCGTGAACAACCAAAGATG
TCTATTGATCTCATTGAAAGAAGGCTACGACGCTGTGTCGCCACACCTTG
ACAAACTTATTAGTGGCAAGTGCCTACCAGGGCTCAGCTAAAAGCTTTCT
AGACCAT

BS21516.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:02:19
Subject Length Description Subject Range Query Range Score Percent Strand
Acp53C14c-RB 375 CG33530-PB 1..375 17..391 1875 100 Plus
Acp53C14c-RA 375 CG33530-PA 1..375 17..391 1875 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:02:21
Subject Length Description Subject Range Query Range Score Percent Strand
Acp53C14c-RB 511 CG33530-RB 109..485 16..392 1885 100 Plus
Acp53C14c-RA 564 CG33530-RA 162..538 16..392 1885 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:02:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16750802..16751135 392..59 1670 100 Minus
2R 25286936 2R 16751193..16751235 58..16 215 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:02:18 has no hits.

BS21516.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:37:59 Download gff for BS21516.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14c-RA 137..509 17..389 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:46:17 Download gff for BS21516.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14c-RA 137..509 17..389 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:54:54 Download gff for BS21516.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14c-RA 163..535 17..389 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:54:54 Download gff for BS21516.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16750805..16751135 59..389 100 <- Minus
2R 16751193..16751234 17..58 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:46:17 Download gff for BS21516.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12638310..12638640 59..389 100 <- Minus
arm_2R 12638698..12638739 17..58 100   Minus

BS21516.pep Sequence

Translation from 16 to 390

> BS21516.pep
MKSKQVFYIAFSLLLLGSLLPNEVESLRVDLNKLAECTESGLKVATTLLV
RAIPCVKKLAKCADFRAIKTKDLDITALALLGYQYLQTVVNNQRCLLISL
KEGYDAVSPHLDKLISGKCLPGLS*

BS21516.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:05:32
Subject Length Description Subject Range Query Range Score Percent Strand
Acp53C14c-PB 124 CG33530-PB 1..124 1..124 619 100 Plus
Acp53C14c-PA 124 CG33530-PA 1..124 1..124 619 100 Plus