Clone BS21518 Report

Search the DGRC for BS21518

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:215
Well:18
Vector:pDNR-Dual
Associated Gene/TranscriptIlp5-RA
Protein status:BS21518.pep: gold
Sequenced Size:359

Clone Sequence Records

BS21518.complete Sequence

359 bp assembled on 2011-01-18

GenBank Submission: KX801551

> BS21518.complete
GAAGTTATCAGTCGACATGATGTTCCGCTCCGTGATCCCAGTTCTCCTGT
TCCTGATCCCGCTCCTGCTATCCGCCCAGGCCGCAAACTCGCTGCGGGCT
TGTGGCCCCGCCTTGATGGACATGCTGAGGGTTGCCTGTCCCAATGGATT
CAATTCAATGTTCGCCAAACGAGGCACCTTGGGCCTATTCGATTATGAGG
ACCACTTGGCGGATTTGGATAGCTCCGAATCTCACCACATGAACTCACTG
TCGAGCATTCGGCGCGATTTTCGCGGCGTTGTCGACTCCTGTTGCCGCAA
ATCGTGTTCCTTTTCCACGTTGAGGGCATACTGCGACTCCTAAAAGCTTT
CTAGACCAT

BS21518.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:02:28
Subject Length Description Subject Range Query Range Score Percent Strand
Ilp5-RA 324 CG33273-PA 1..324 20..343 1620 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:02:29
Subject Length Description Subject Range Query Range Score Percent Strand
Ilp5-RA 478 CG33273-RA 25..353 17..345 1645 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:02:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9823474..9823639 345..180 830 100 Minus
3L 28110227 3L 9823711..9823873 179..17 815 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:02:28 has no hits.

BS21518.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:38:00 Download gff for BS21518.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp5-RA 25..349 17..341 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:46:21 Download gff for BS21518.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp5-RA 25..349 17..341 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:54:57 Download gff for BS21518.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp5-RA 25..349 17..341 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:54:57 Download gff for BS21518.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9823478..9823639 180..341 100 <- Minus
3L 9823711..9823873 17..179 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:46:21 Download gff for BS21518.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9816578..9816739 180..341 100 <- Minus
arm_3L 9816811..9816973 17..179 100   Minus

BS21518.pep Sequence

Translation from 16 to 342

> BS21518.pep
MMFRSVIPVLLFLIPLLLSAQAANSLRACGPALMDMLRVACPNGFNSMFA
KRGTLGLFDYEDHLADLDSSESHHMNSLSSIRRDFRGVVDSCCRKSCSFS
TLRAYCDS*

BS21518.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:05:35
Subject Length Description Subject Range Query Range Score Percent Strand
Ilp5-PA 107 CG33273-PA 1..107 2..108 557 100 Plus