Clone BS21522 Report

Search the DGRC for BS21522

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:215
Well:22
Vector:pDNR-Dual
Associated Gene/TranscriptCG13299-RA
Protein status:BS21522.pep: gold
Sequenced Size:371

Clone Sequence Records

BS21522.complete Sequence

371 bp assembled on 2011-01-18

GenBank Submission: KX802542

> BS21522.complete
GAAGTTATCAGTCGACATGACCTCAGAAAGCAAGATGGTTTTGCTCTTCC
TTATCGGATGTCTCGTCATGCAGACAATCAACGCCCTGCCATTCGATAGA
TTCAGCCAGGAGGATGACGAACGGAACAACGAGATCAGCGGCGAATGGTT
CAAGAAACCCATCCTCAGGTTCGATCGTCTTTTTGCCACCGAAGAATCAC
CGTCGGGAAGTCGGAAAGAAGTGAGAAGGCCCAGCAGAAGCGACAAGGGT
GAAACCACGGAGAGCTCCAAGCACGCCCACTCCATGATCACCTCCATGCT
CGGATTCGTGAGCAGTGTCATCAACTTTGGCAGGACCTTCATAAGGGATC
AATAGAAGCTTTCTAGACCAT

BS21522.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:01:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG13299-RA 339 CG13299-PA 1..339 17..355 1695 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:01:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG13299-RA 494 CG13299-RA 38..378 17..357 1705 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:01:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6231921..6232200 357..78 1400 100 Minus
3L 28110227 3L 6232264..6232324 77..17 305 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:01:56 has no hits.

BS21522.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:37:56 Download gff for BS21522.complete
Subject Subject Range Query Range Percent Splice Strand
CG13299-RA 38..376 17..355 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:46:07 Download gff for BS21522.complete
Subject Subject Range Query Range Percent Splice Strand
CG13299-RA 38..376 17..355 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:54:46 Download gff for BS21522.complete
Subject Subject Range Query Range Percent Splice Strand
CG13299-RA 38..376 17..355 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:54:46 Download gff for BS21522.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6232264..6232324 17..77 100   Minus
3L 6231923..6232200 78..355 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:46:07 Download gff for BS21522.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6225023..6225300 78..355 100 <- Minus
arm_3L 6225364..6225424 17..77 100   Minus

BS21522.pep Sequence

Translation from 16 to 354

> BS21522.pep
MTSESKMVLLFLIGCLVMQTINALPFDRFSQEDDERNNEISGEWFKKPIL
RFDRLFATEESPSGSRKEVRRPSRSDKGETTESSKHAHSMITSMLGFVSS
VINFGRTFIRDQ*

BS21522.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:05:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG13299-PA 112 CG13299-PA 1..112 1..112 571 100 Plus