Clone BS21526 Report

Search the DGRC for BS21526

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:215
Well:26
Vector:pDNR-Dual
Associated Gene/TranscriptCG13748-RA
Protein status:BS21526.pep: full length peptide match
Sequenced Size:374

Clone Sequence Records

BS21526.complete Sequence

374 bp assembled on 2011-01-18

GenBank Submission: KX800960

> BS21526.complete
GAAGTTATCAGTCGACATGCGCGGACAACTGAAAGAGTACGTTGGAGTGG
CAGTGGTGCTGATCCTGCTGGCGGGGATCAGATGGAGCGAGGCGTTTCCC
ATGGACCTCTACGACGACGTGAGCGACTTCTTTGACGCCATCTCGCTGGA
CGATGTGGCCAATACCGGGCGCAACACCCATCCGGAGCAGTTCTGCCTCA
TGCCGGCACGCAAGGGCGTCTGCCGCGCCCTGATCCCCCGTTGGCGCTAC
GATCCGGAGCAGAAGAAGTGCGTGGAGTTCAAGTTCGGCGGCTGTGACGG
CAACGAGAACAACTTCGCCAGCTACAAGGACTGCATGTCCACCTGCGAGG
GCATGTAGAAGCTTTCTAGACCAT

BS21526.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:01:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG13748-RA 342 CG13748-PA 1..342 17..358 1710 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:01:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG13748-RA 722 CG13748-RA 55..396 17..358 1710 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:01:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8940469..8940810 17..358 1710 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:01:17 has no hits.

BS21526.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:37:50 Download gff for BS21526.complete
Subject Subject Range Query Range Percent Splice Strand
CG13748-RA 55..396 17..358 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:45:49 Download gff for BS21526.complete
Subject Subject Range Query Range Percent Splice Strand
CG13748-RA 55..396 17..358 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:54:29 Download gff for BS21526.complete
Subject Subject Range Query Range Percent Splice Strand
CG13748-RA 55..396 17..358 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:54:29 Download gff for BS21526.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8940469..8940810 17..358 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:45:49 Download gff for BS21526.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4827974..4828315 17..358 100   Plus

BS21526.pep Sequence

Translation from 16 to 357

> BS21526.pep
MRGQLKEYVGVAVVLILLAGIRWSEAFPMDLYDDVSDFFDAISLDDVANT
GRNTHPEQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNF
ASYKDCMSTCEGM*

BS21526.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:05:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG13748-PA 113 CG13748-PA 1..113 1..113 620 100 Plus
CG3604-PB 132 CG3604-PB 9..105 8..110 146 35 Plus
CG3604-PA 132 CG3604-PA 9..105 8..110 146 35 Plus
Acp24A4-PC 78 CG31779-PC 23..76 58..110 139 44.4 Plus
Acp24A4-PB 78 CG31779-PB 23..76 58..110 139 44.4 Plus