Clone BS21530 Report

Search the DGRC for BS21530

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:215
Well:30
Vector:pDNR-Dual
Associated Gene/TranscriptCG15577-RA
Protein status:BS21530.pep: gold
Sequenced Size:332

Clone Sequence Records

BS21530.complete Sequence

332 bp assembled on 2011-01-18

GenBank Submission: KX803409

> BS21530.complete
GAAGTTATCAGTCGACATGCCCGTCACCTACAGGACTCGCACACTGCCGC
AACAGCGGAAGTTGGTCCCCAACCTACTGAGGTCCATACTACGCGTCCTG
GAGGAGACGCGCCGACCCATGAGTGACAAAGAGTTGAACTTCGTCCTGGG
CGTCCAGTACCGACGCAACGATCCGGAGTTCTATCGCCAAGTGCAAGTCA
ACCTGCGCGATGGCGTCGAATACGGCATTCTGAAACGCCAGGGAAACCAG
TTTTCGCTGCGATCCCGACGCCTTGGTGAACTGATGTCTACTCTTGGATC
CTCGCCAAACCGCTAAAAGCTTTCTAGACCAT

BS21530.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:18:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG15577-RA 300 CG15577-PA 1..300 17..316 1500 100 Plus
CG15578-RA 270 CG15578-PA 36..235 61..260 475 82.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:18:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG15577-RA 508 CG15577-RA 94..395 16..317 1510 100 Plus
CG15578-RA 415 CG15578-RA 135..334 61..260 475 82.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:18:11
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4276606..4276907 317..16 1510 100 Minus
X 23542271 X 4277628..4277827 260..61 475 82.5 Minus
Blast to na_te.dros performed on 2014-11-26 16:18:12 has no hits.

BS21530.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:39:56 Download gff for BS21530.complete
Subject Subject Range Query Range Percent Splice Strand
CG15577-RA 95..392 17..314 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:53:07 Download gff for BS21530.complete
Subject Subject Range Query Range Percent Splice Strand
CG15577-RA 95..392 17..314 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:00:56 Download gff for BS21530.complete
Subject Subject Range Query Range Percent Splice Strand
CG15577-RA 95..392 17..314 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:00:56 Download gff for BS21530.complete
Subject Subject Range Query Range Percent Splice Strand
X 4276609..4276906 17..314 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:53:07 Download gff for BS21530.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4170642..4170939 17..314 100   Minus

BS21530.pep Sequence

Translation from 16 to 315

> BS21530.pep
MPVTYRTRTLPQQRKLVPNLLRSILRVLEETRRPMSDKELNFVLGVQYRR
NDPEFYRQVQVNLRDGVEYGILKRQGNQFSLRSRRLGELMSTLGSSPNR*

BS21530.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:05:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG15577-PA 99 CG15577-PA 1..99 1..99 502 100 Plus
CG15578-PA 89 CG15578-PA 7..78 9..81 254 68.5 Plus