Clone BS21534 Report

Search the DGRC for BS21534

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:215
Well:34
Vector:pDNR-Dual
Associated Gene/TranscriptTim13-RA
Protein status:BS21534.pep: full length peptide match
Sequenced Size:311

Clone Sequence Records

BS21534.complete Sequence

311 bp assembled on 2011-01-18

GenBank Submission: KX801603

> BS21534.complete
GAAGTTATCAGTCGACATGGCGGCTGCCAACATGGAGAAGGGTGAGCTGA
TGAACCAGGTGAAACAACAGATCGCATTGGCCAATGCCCAGGAGATGCTC
TCGAAGATGACGGAGAAGTGCTTCAAGAAGTGCATCCAGAAGCCGGGAAA
ATCACTGGACTCCACCGAGCAGCGTTGCATTTCGCAGTGCATGGATCGCT
TCATGGACGCCTGGAATCTGGTGTCGCGCACCTATGGCAATCGTCTGCAG
CGTGAACAGTACAGGACCATGGAATCGTTGGAGATGACCAGCTAGAAGCT
TTCTAGACCAT

BS21534.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
Tim13-RA 279 CG11611-PA 1..279 17..295 1395 100 Plus
CG34132-RA 255 CG34132-PA 17..200 33..216 260 76.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:02:39
Subject Length Description Subject Range Query Range Score Percent Strand
Tim13-RA 442 CG11611-RA 86..368 13..295 1400 99.6 Plus
CG34132-RA 535 CG34132-RA 163..346 33..216 260 76.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:02:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11774134..11774416 295..13 1400 99.6 Minus
2L 23513712 2L 7885665..7885781 33..149 210 78.6 Plus
Blast to na_te.dros performed on 2014-11-26 16:02:37 has no hits.

BS21534.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:38:01 Download gff for BS21534.complete
Subject Subject Range Query Range Percent Splice Strand
Tim13-RA 90..368 17..295 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:46:25 Download gff for BS21534.complete
Subject Subject Range Query Range Percent Splice Strand
Tim13-RA 90..368 17..295 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:55:01 Download gff for BS21534.complete
Subject Subject Range Query Range Percent Splice Strand
Tim13-RA 90..368 17..295 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:55:01 Download gff for BS21534.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11774134..11774412 17..295 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:46:25 Download gff for BS21534.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11767234..11767512 17..295 100   Minus

BS21534.pep Sequence

Translation from 16 to 294

> BS21534.pep
MAAANMEKGELMNQVKQQIALANAQEMLSKMTEKCFKKCIQKPGKSLDST
EQRCISQCMDRFMDAWNLVSRTYGNRLQREQYRTMESLEMTS*

BS21534.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:05:38
Subject Length Description Subject Range Query Range Score Percent Strand
Tim13-PA 92 CG11611-PA 1..92 1..92 475 100 Plus
CG34132-PA 84 CG34132-PA 1..81 1..81 350 76.5 Plus
CG42302-PA 121 CG42302-PA 8..77 12..81 185 48.6 Plus