Clone BS21536 Report

Search the DGRC for BS21536

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:215
Well:36
Vector:pDNR-Dual
Associated Gene/TranscriptCG34026-RA
Protein status:BS21536.pep: full length peptide match
Sequenced Size:386

Clone Sequence Records

BS21536.complete Sequence

386 bp assembled on 2011-01-18

GenBank Submission: KX804061

> BS21536.complete
GAAGTTATCAGTCGACATGAAATATCCCACAATTATTTTATTTGCGCTAG
CCGCATTCATTTTGCCAACATTTGCCGCAAATGACTACCTGTGGGGTGAA
GTTGGTGCAGATGATTACCAATTGGCAAAGGATACGGTTTCGAAGGCGTT
TTTCGTTGGTCTAGTGCAGACGAAAAAATACGTATTCAAGCAGTCGGACA
ACCTAAATGCGTTGACCATTACGGCAATTAAGATTACCGACAAAAAGAAG
AGTCACGGAGCAACTGCTGTATTGGTCAGTGGAGGTCCTGGATCCAAAGG
AGCAACTATTAAGTTCACTTCCGAACGAGGTTACGGCATCAAGGATATCG
TGGAAATATGGGGTCGTTAAAAGCTTTCTAGACCAT

BS21536.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:02:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG34026-RB 354 CG34026-PB 1..354 17..370 1770 100 Plus
CG34026-RA 354 CG34026-PA 1..354 17..370 1770 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:02:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG34026-RB 747 CG34026-RB 27..381 17..371 1775 100 Plus
CG34026-RA 427 CG34026-RA 27..381 17..371 1775 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:02:46
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9533844..9534024 17..197 905 100 Plus
X 23542271 X 9534084..9534259 196..371 880 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:02:47 has no hits.

BS21536.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:38:02 Download gff for BS21536.complete
Subject Subject Range Query Range Percent Splice Strand
CG34026-RA 27..378 17..368 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:46:29 Download gff for BS21536.complete
Subject Subject Range Query Range Percent Splice Strand
CG34026-RA 27..378 17..368 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:55:04 Download gff for BS21536.complete
Subject Subject Range Query Range Percent Splice Strand
CG34026-RA 27..378 17..368 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:55:04 Download gff for BS21536.complete
Subject Subject Range Query Range Percent Splice Strand
X 9533844..9534023 17..196 100 -> Plus
X 9534085..9534256 197..368 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:46:29 Download gff for BS21536.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 9427877..9428056 17..196 100 -> Plus
arm_X 9428118..9428289 197..368 100   Plus

BS21536.pep Sequence

Translation from 16 to 369

> BS21536.pep
MKYPTIILFALAAFILPTFAANDYLWGEVGADDYQLAKDTVSKAFFVGLV
QTKKYVFKQSDNLNALTITAIKITDKKKSHGATAVLVSGGPGSKGATIKF
TSERGYGIKDIVEIWGR*

BS21536.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:05:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG34026-PB 117 CG34026-PB 1..117 1..117 598 100 Plus
CG34026-PA 117 CG34026-PA 1..117 1..117 598 100 Plus
CG30413-PA 122 CG30413-PA 28..120 22..116 192 48.4 Plus