Clone BS21537 Report

Search the DGRC for BS21537

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:215
Well:37
Vector:pDNR-Dual
Associated Gene/TranscriptCG33977-RA
Protein status:BS21537.pep: full length peptide match
Sequenced Size:317

Clone Sequence Records

BS21537.complete Sequence

317 bp assembled on 2011-01-18

GenBank Submission: KX801728

> BS21537.complete
GAAGTTATCAGTCGACATGACAAATCTACAACGCTGGCTATTTTACGCAT
CGCTCTTTGCGATTCCCTATCTCTCCGTTGTTTTGGGAACAGTGCAAACG
CCACTAACTACCAAGTATTTCCTGCACATTCAGCTTTTACCACTTTTGCT
CCTCGTGATTTTTGGAATATATTCCGTTTGGACTGTTCTATATAGAACTC
TGACTTTTAACGATTGTCCCGAGGCCGCCAAGGAGCTGCAGGATGAAATT
CAGGAGGCTCGCAAGGATTTGATAGCCAAGGGATTTCGGTTTCGAGATTA
GAAGCTTTCTAGACCAT

BS21537.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:18:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG33977-RA 285 CG33977-PA 1..285 17..301 1425 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:18:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG33977-RA 425 CG33977-RA 64..348 17..301 1425 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:18:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13402839..13402988 166..17 750 100 Minus
3R 32079331 3R 13402636..13402770 301..167 675 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:18:40 has no hits.

BS21537.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:39:59 Download gff for BS21537.complete
Subject Subject Range Query Range Percent Splice Strand
CG33977-RA 62..346 17..301 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:53:22 Download gff for BS21537.complete
Subject Subject Range Query Range Percent Splice Strand
CG33977-RA 42..326 17..301 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:01:08 Download gff for BS21537.complete
Subject Subject Range Query Range Percent Splice Strand
CG33977-RA 64..348 17..301 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:01:08 Download gff for BS21537.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13402636..13402770 167..301 100 <- Minus
3R 13402839..13402988 17..166 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:53:22 Download gff for BS21537.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9228358..9228492 167..301 100 <- Minus
arm_3R 9228561..9228710 17..166 100   Minus

BS21537.pep Sequence

Translation from 16 to 300

> BS21537.pep
MTNLQRWLFYASLFAIPYLSVVLGTVQTPLTTKYFLHIQLLPLLLLVIFG
IYSVWTVLYRTLTFNDCPEAAKELQDEIQEARKDLIAKGFRFRD*

BS21537.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:05:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG33977-PA 94 CG33977-PA 1..94 1..94 485 100 Plus