BS21547.complete Sequence
248 bp assembled on 2011-01-18
GenBank Submission: KX802437
> BS21547.complete
GAAGTTATCAGTCGACATGGTGCAGATGATATTCCTGTTTGCTATCCTTG
CTGTAATGACCATTGTCCTAATGGAGGCCAACACTGTTTTGGCACGTGAT
TGCCTATCTGGAACTTTCGGAGGTCCTTGCTGGGCCTGGAGTGGAGAAAA
GTGCCGCCGTCTCTGCATTGAGGAGGGACATGTCAGTGGACACTGCAGTG
GCGCAATGAAGTGCTGGTGCGAAGGATGCTAGAAGCTTTCTAGACCAT
BS21547.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:18:31
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Drsl3-RA | 216 | CG32283-PA | 1..216 | 17..232 | 1080 | 100 | Plus |
| Drsl4-RA | 216 | CG32282-PA | 20..214 | 36..230 | 450 | 82.1 | Plus |
| Drsl2-RA | 213 | CG32279-PA | 132..211 | 151..230 | 205 | 83.8 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:18:32
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Drsl3-RA | 360 | CG32283-RA | 29..255 | 7..233 | 1105 | 99.1 | Plus |
| Drsl4-RA | 323 | CG32282-RA | 37..231 | 36..230 | 450 | 82.1 | Plus |
| Drsl2-RA | 333 | CG32279-RA | 158..237 | 151..230 | 205 | 83.8 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:18:28
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3L | 28110227 | 3L | 3315024..3315250 | 7..233 | 1105 | 99.1 | Plus |
| 3L | 28110227 | 3L | 3315656..3315850 | 36..230 | 450 | 82.1 | Plus |
| 3L | 28110227 | 3L | 3314506..3314585 | 151..230 | 205 | 83.8 | Plus |
Blast to na_te.dros performed on 2014-11-26 16:18:30 has no hits.
BS21547.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:39:58 Download gff for
BS21547.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| dro3-RA | 39..254 | 17..232 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:53:17 Download gff for
BS21547.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Drsl3-RA | 39..254 | 17..232 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:01:04 Download gff for
BS21547.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Drsl3-RA | 39..254 | 17..232 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:01:04 Download gff for
BS21547.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 3315034..3315249 | 17..232 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:53:17 Download gff for
BS21547.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3L | 3315034..3315249 | 17..232 | 100 | | Plus |
BS21547.pep Sequence
Translation from 16 to 231
> BS21547.pep
MVQMIFLFAILAVMTIVLMEANTVLARDCLSGTFGGPCWAWSGEKCRRLC
IEEGHVSGHCSGAMKCWCEGC*
BS21547.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:05:54
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Drsl3-PA | 71 | CG32283-PA | 1..71 | 1..71 | 401 | 100 | Plus |
| Drsl4-PA | 71 | CG32282-PA | 1..71 | 1..71 | 280 | 69 | Plus |
| Drsl2-PA | 70 | CG32279-PA | 1..70 | 1..71 | 260 | 64.8 | Plus |
| Drsl5-PA | 69 | CG10812-PA | 1..69 | 2..71 | 231 | 58.6 | Plus |
| Drs-PA | 70 | CG10810-PA | 1..70 | 1..71 | 230 | 56.3 | Plus |
