Clone BS21549 Report

Search the DGRC for BS21549

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:215
Well:49
Vector:pDNR-Dual
Associated Gene/TranscriptCcp84Af-RA
Protein status:BS21549.pep: gold
Sequenced Size:488

Clone Sequence Records

BS21549.complete Sequence

488 bp assembled on 2011-01-18

GenBank Submission: KX800866

> BS21549.complete
GAAGTTATCAGTCGACATGGCCTTCAAGTTCTTCGCTGTTCTCGCCCTCA
TCTCGGCCGCCAGTGCCGGAGTTCTTCCCGTCCAGCAGGTGTATCACGCC
GCCCCCGCCGTGGCCACCTACGCCCAAGCACCTGTCGCCGTTGCCCACGC
CCAGCCGGTTCTGACCAAGGCCACCGAGGAATACGATCCCCATCCCCAGT
ACAAGTTCGCCTACGATGTCCAGGACTCCCTTTCCGGAGACTCGAAGAGT
CAGGTTGAGGAGCGTGATGGCGACGTGGTCCATGGCGAGTACTCCCTGAT
CGATTCCGATGGCTACAAGCGCATTGTCCAGTACACCTCCGACCCGGTCA
ACGGTTTCAACGCCGTCGTCAACCGCGTTCCCCTGGATCACGTGAAGACC
GTGGTGAAGACCGTGGCTCCTGTGGCCGTGGCTGCTGCCCCTATCCCAGT
GGCCTACCACCAGCACCACTGAAAGCTTTCTAGACCAT

BS21549.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:19:30
Subject Length Description Subject Range Query Range Score Percent Strand
Ccp84Af-RA 456 CG1331-PA 1..456 17..472 2280 100 Plus
Ccp84Ad-RA 600 CG2341-PA 1..370 17..386 1205 88.4 Plus
Cpr5C-RA 438 CG4052-PA 138..410 148..426 595 81.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:19:32
Subject Length Description Subject Range Query Range Score Percent Strand
Ccp84Af-RA 580 CG1331-RA 53..509 16..472 2285 100 Plus
Ccp84Ad-RA 735 CG2341-RA 67..436 17..386 1205 88.4 Plus
Cpr5C-RA 605 CG4052-RA 192..464 148..426 595 81.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6689673..6690118 472..27 2230 100 Minus
3R 32079331 3R 6692884..6693228 42..386 1170 89.3 Plus
X 23542271 X 5804931..5805203 148..426 595 81.7 Plus
3R 32079331 3R 6704277..6704571 86..386 465 77.7 Plus
3R 32079331 3R 6702374..6702668 386..86 420 76.7 Minus
3R 32079331 3R 6687088..6687275 176..363 340 78.7 Plus
3R 32079331 3R 6691265..6691450 370..185 315 78 Minus
3R 32079331 3R 6695740..6695935 386..191 275 76 Minus
3L 28110227 3L 4215945..4216123 185..363 250 76 Plus
2L 23513712 2L 11945176..11945341 171..336 215 75.3 Plus
3L 28110227 3L 4211080..4211255 360..185 205 74.4 Minus
Blast to na_te.dros performed on 2014-11-26 16:19:29 has no hits.

BS21549.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:40:05 Download gff for BS21549.complete
Subject Subject Range Query Range Percent Splice Strand
Ccp84Af-RA 54..508 17..471 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:53:41 Download gff for BS21549.complete
Subject Subject Range Query Range Percent Splice Strand
Ccp84Af-RA 54..508 17..471 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:01:28 Download gff for BS21549.complete
Subject Subject Range Query Range Percent Splice Strand
Ccp84Af-RA 54..508 17..471 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:01:28 Download gff for BS21549.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6689674..6690122 21..471 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:53:41 Download gff for BS21549.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2515396..2515844 21..471 99   Minus

BS21549.pep Sequence

Translation from 16 to 471

> BS21549.pep
MAFKFFAVLALISAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLT
KATEEYDPHPQYKFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGY
KRIVQYTSDPVNGFNAVVNRVPLDHVKTVVKTVAPVAVAAAPIPVAYHQH
H*

BS21549.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:06:14
Subject Length Description Subject Range Query Range Score Percent Strand
Ccp84Af-PA 151 CG1331-PA 1..151 1..151 775 100 Plus
Ccp84Ad-PA 199 CG2341-PA 1..151 1..147 598 82.1 Plus
Cpr5C-PA 145 CG4052-PA 1..144 1..148 542 74.7 Plus
Ccp84Aa-PA 205 CG2360-PA 1..151 1..147 491 69.3 Plus
Ccp84Ab-PA 221 CG1252-PA 1..151 1..147 486 68.6 Plus