Clone BS21569 Report

Search the DGRC for BS21569

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:215
Well:69
Vector:pDNR-Dual
Associated Gene/TranscriptNimB3-RA
Protein status:BS21569.pep: gold
Sequenced Size:401

Clone Sequence Records

BS21569.complete Sequence

401 bp assembled on 2011-01-18

GenBank Submission: KX801164

> BS21569.complete
GAAGTTATCAGTCGACATGCACTTGACATCCACGCTGATTGGACTCCTTA
TCTGCGGTCTGGGGATCGAGCTGCCCACGCGCACTGCCGCACAATTCTGG
TCGGTGGATCCTGTTACGCAGTGGCGAAAAGAGGCTCTGGCCGAGAGGGG
ATCCGGCATCTGTTACAGGACGCTCACCGTGGAAACCATCAATCCCAACT
CCAGAAATCGTCAGTTCTCCTACTGCTGCGATGGTTATGTGAATAAGGGA
ACAAGCCAGAACCTGAAGTGCGAGCCCATTTGCTCGGAGGACTGCTCCAA
TGGATTGTGCCTGGCGCCCGAGGAGTGCGAGTGTGCTCCGGGTTACTATC
GGAGTAACAAAAGGTGTCGTTTTGTCTTGGAATAAAAGCTTTCTAGACCA
T

BS21569.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:20:40
Subject Length Description Subject Range Query Range Score Percent Strand
NimB3-RA 369 CG34003-PA 1..369 17..385 1845 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:20:42
Subject Length Description Subject Range Query Range Score Percent Strand
NimB3-RA 466 CG34003-RA 71..443 13..385 1850 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:20:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13967487..13967694 385..178 1040 100 Minus
2L 23513712 2L 13967751..13967915 177..13 810 99.4 Minus
Blast to na_te.dros performed on 2014-11-26 16:20:40 has no hits.

BS21569.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:40:14 Download gff for BS21569.complete
Subject Subject Range Query Range Percent Splice Strand
nimB3-RA 56..422 17..383 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:54:11 Download gff for BS21569.complete
Subject Subject Range Query Range Percent Splice Strand
NimB3-RA 75..441 17..383 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:01:57 Download gff for BS21569.complete
Subject Subject Range Query Range Percent Splice Strand
NimB3-RA 75..441 17..383 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:01:57 Download gff for BS21569.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13967489..13967694 178..383 100 <- Minus
2L 13967751..13967911 17..177 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:54:11 Download gff for BS21569.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13967489..13967694 178..383 100 <- Minus
arm_2L 13967751..13967911 17..177 100   Minus

BS21569.pep Sequence

Translation from 16 to 384

> BS21569.pep
MHLTSTLIGLLICGLGIELPTRTAAQFWSVDPVTQWRKEALAERGSGICY
RTLTVETINPNSRNRQFSYCCDGYVNKGTSQNLKCEPICSEDCSNGLCLA
PEECECAPGYYRSNKRCRFVLE*

BS21569.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:06:36
Subject Length Description Subject Range Query Range Score Percent Strand
NimB3-PA 122 CG34003-PA 1..122 1..122 675 100 Plus
NimB2-PA 421 CG31839-PA 132..209 46..113 160 36.7 Plus