Clone BS21570 Report

Search the DGRC for BS21570

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:215
Well:70
Vector:pDNR-Dual
Associated Gene/TranscriptCG30413-RA
Protein status:BS21570.pep: gold
Sequenced Size:401

Clone Sequence Records

BS21570.complete Sequence

401 bp assembled on 2011-01-18

GenBank Submission: KX801498

> BS21570.complete
GAAGTTATCAGTCGACATGTACCTCTTTGGCGTTTTCCTGCTCTTGGTCG
GCACTCACGTCTGCTTCATCGATGCGAACTTCGGCAGCGGAGAAGGAAAT
GACTACACCTACGGCACCCAGGCAACAACGGATACCCTCATCGCCAGTGA
GACCATAACCAAGTCGAAATCCTTGCTGGGAATCACCACGAAGACGTATA
CTCTAACCCAGGCAGGAACTGCAAAGACCATCACCTACATCAAGATCACG
GATCTTAAGAAAATGCGTGGAGCCACTGCCGAAATTACCTCCGGTGGAGT
GGGATCCACGACAGTCACGATCAAATTCACCTCTGCACGGGGAGCTGGTA
TCAAGTCCCAAGTGGTGATATACGGATCAACCTAAAAGCTTTCTAGACCA
T

BS21570.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:19:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG30413-RA 369 CG30413-PA 1..369 17..385 1845 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:20:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG30413-RA 526 CG30413-RA 44..412 17..385 1845 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:19:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23329657..23330025 385..17 1845 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:19:58 has no hits.

BS21570.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:40:09 Download gff for BS21570.complete
Subject Subject Range Query Range Percent Splice Strand
CG30413-RA 46..412 17..383 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:53:52 Download gff for BS21570.complete
Subject Subject Range Query Range Percent Splice Strand
CG30413-RA 44..410 17..383 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:01:39 Download gff for BS21570.complete
Subject Subject Range Query Range Percent Splice Strand
CG30413-RA 44..410 17..383 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:01:39 Download gff for BS21570.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23329659..23330025 17..383 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:53:52 Download gff for BS21570.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19217182..19217548 17..383 100   Minus

BS21570.pep Sequence

Translation from 16 to 384

> BS21570.pep
MYLFGVFLLLVGTHVCFIDANFGSGEGNDYTYGTQATTDTLIASETITKS
KSLLGITTKTYTLTQAGTAKTITYIKITDLKKMRGATAEITSGGVGSTTV
TIKFTSARGAGIKSQVVIYGST*

BS21570.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG30413-PA 122 CG30413-PA 1..122 1..122 610 100 Plus
CG34026-PB 117 CG34026-PB 22..116 28..120 192 48.4 Plus
CG34026-PA 117 CG34026-PA 22..116 28..120 192 48.4 Plus