Clone BS21575 Report

Search the DGRC for BS21575

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:215
Well:75
Vector:pDNR-Dual
Associated Gene/TranscriptCG3713-RA
Protein status:BS21575.pep: full length peptide match
Sequenced Size:284

Clone Sequence Records

BS21575.complete Sequence

284 bp assembled on 2011-01-18

GenBank Submission: KX805476

> BS21575.complete
GAAGTTATCAGTCGACATGTTTCTGGGCTTCTTGGTGGATCTGCTGTACT
GCCGACGCTGCGGGGACGACTGTATGATGGAATTCCCATCGACTTCCGCG
AATGAAGAAGCAGCGCCGAAAGTGGTAAAGGTCGAACTGCCGCCGCTGCC
GCCACTGACCTTTGAACTCATCCGCAATCCATTGGCTGCCGACCAGGAGT
GCGATGATAGCTTCGAAGGCTTCGTCGATGGTTATGATGATCCCAGGCTG
CCGGAAACCATCATCTGAAAGCTTTCTAGACCAT

BS21575.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:21:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG3713-RB 252 CG3713-PB 1..252 17..268 1260 100 Plus
CG3713-RA 252 CG3713-PA 1..252 17..268 1260 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:21:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG3713-RB 500 CG3713-RB 55..306 17..268 1260 100 Plus
CG3713-RA 987 CG3713-RA 55..306 17..268 1260 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:20:58
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 846852..847103 268..17 1260 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:20:59 has no hits.

BS21575.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:40:16 Download gff for BS21575.complete
Subject Subject Range Query Range Percent Splice Strand
CG3713-RA 72..316 23..267 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:54:21 Download gff for BS21575.complete
Subject Subject Range Query Range Percent Splice Strand
CG3713-RA 61..305 23..267 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:02:03 Download gff for BS21575.complete
Subject Subject Range Query Range Percent Splice Strand
CG3713-RA 61..305 23..267 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:02:03 Download gff for BS21575.complete
Subject Subject Range Query Range Percent Splice Strand
X 846853..847097 23..267 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:54:21 Download gff for BS21575.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 740886..741130 23..267 100   Minus

BS21575.pep Sequence

Translation from 16 to 267

> BS21575.pep
MFLGFLVDLLYCRRCGDDCMMEFPSTSANEEAAPKVVKVELPPLPPLTFE
LIRNPLAADQECDDSFEGFVDGYDDPRLPETII*

BS21575.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:06:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG3713-PB 83 CG3713-PB 1..83 1..83 448 100 Plus
CG3713-PA 83 CG3713-PA 1..83 1..83 448 100 Plus